KEGG   Pseudomonas aeruginosa PAO1: PA0157
Entry
PA0157            CDS       T00035                                 
Name
(RefSeq) resistance-nodulation-cell division (RND) efflux membrane fusion protein
  KO
K21137  membrane fusion protein, multidrug efflux system
Organism
pae  Pseudomonas aeruginosa PAO1
Brite
KEGG Orthology (KO) [BR:pae00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pae02000]
    PA0157
Transporters [BR:pae02000]
 Other transporters
  Accessory factors involved in transport [TC:8]
   PA0157
SSDB
Motif
Pfam: HlyD_D23 HlyD_3 Biotin_lipoyl_2 Borrelia_P83 ATG14
Other DBs
NCBI-GeneID: 882134
NCBI-ProteinID: NP_248847
UniProt: Q9I6X5
Structure
Position
178455..179525
AA seq 356 aa
MKPFSLAGLFGFALLLSGCGDEPPPAPPRPVLTVTVKTLKNDDLGRFAGSIQARYESVLG
FRTNGRIASRLFDVGDFVGKGALLATLDPTDQQNQLRASQGDLASAEAQLIDAQANARRQ
EELFARSVTAQARLDDARTRLKTSQASFDQAKAAVQQARDQLSYTRLVTDFDGVITTWHA
EAGQVVSAGQAVVTLARPEVREAVFDLPTEVAESLPADARFLVSAQLDPQARTTGSIREL
GPQADASTRTRRVRLSLAQTPEAFRLGSTIQVQLSSAGSVRSVLPASVLLERDGKTQVWV
VDGKQSSVALREVQVLSRDERQVVIGQGLADGDRVVRAGVNSLKPGQKIKLDEDAR
NT seq 1071 nt   +upstreamnt  +downstreamnt
atgaagccgttttccctcgccggcctgttcggcttcgccctgctcctctccggctgcggc
gacgagccgccgccggcaccgccgcggccggtgctgacggtgaccgtgaagaccctgaag
aacgacgacctcggtcgcttcgccgggagcatccaggcgcgctacgagagcgtgctcggc
ttccgcaccaacggacggatcgcctcgcgcctgttcgacgtcggtgacttcgtcggcaag
ggcgcgctgctggcgaccctcgaccccaccgaccagcagaaccagttgcgcgccagccag
ggcgacctggccagcgccgaggcacagttgatcgacgcccaggccaatgcccggcgccag
gaagaactgttcgcccgcagcgtcaccgcccaggcgcgcctggacgatgcgcggacccgc
ctgaagaccagccaggccagcttcgaccaggccaaagcggcggtgcagcaggccagggac
cagctttcctacacgcgcctggtgaccgatttcgacggcgtcatcaccacctggcacgcc
gaggccgggcaagtggtcagcgccggccaggcggtggtcaccctggcccggcccgaagtg
cgcgaggcagtcttcgacctgcccaccgaggtcgccgagagcctgccggccgacgcgcgc
ttcctggtcagcgcccagctcgacccgcaggccaggaccaccggcagcatccgcgagctg
ggtccgcaggccgacgcctcgacccgcacccgtcgcgtgcgcctgagcctggcgcagacg
ccggaggcgtttcgcctcggttcgaccatccaggtccagctgagcagcgccggtagcgtg
cgcagcgtgctgccggccagcgtgctgctggagcgcgacggcaagacccaggtctgggtc
gtcgatgggaaacagtccagcgtggccctgcgcgaggtacaggtgctcagccgcgacgaa
cgccaggtggtgatcggacagggcctggccgacggcgaccgggtggtccgcgccggagtc
aacagcctcaagcccggccagaagatcaaactcgacgaggatgcgcgatga

DBGET integrated database retrieval system