KEGG   Pseudomonas aeruginosa PAO1: PA0190
Entry
PA0190            CDS       T00035                                 

Definition
(RefSeq) acid phosphatase
  KO
K09474  acid phosphatase (class A) [EC:3.1.3.2]
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
pae00740  Riboflavin metabolism
pae01100  Metabolic pathways
pae02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pae00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    PA0190
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PA0190
Enzymes [BR:pae01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.2  acid phosphatase
     PA0190
SSDB
Motif
Pfam: PAP2
Other DBs
NCBI-GeneID: 883097
NCBI-ProteinID: NP_248880
UniProt: Q9I6U4
Position
217156..217881
AA seq 241 aa
MNNKTLCPSLLLCLSLLAPLSCLGETAAAPYPLAHPPRLADYLPPPPAADSAAAVADLGA
VLEAQRLRTPEQVRRVRAHDQWEDNVFPFAGDLLGASFDKERLPLTRSFFNRAQENLVEV
LMPAKKHFARPRPYEVTPKVKPVLPPPEGESYPSGHTMDSYFKASLLSMLVPEHHDAFFA
RAEEHAQSRVLAGVHFPSDLEGGQTAAAALVASLLADPAVAADFAAVREELRGALGLPKL
Q
NT seq 726 nt   +upstreamnt  +downstreamnt
atgaacaacaagaccctatgcccttcgctcttgctctgcctttcgctgcttgcaccgctg
tcttgtctcggggagaccgccgccgcgccctatccgctggcccacccaccgcgcctggcc
gactacctcccgccgccgccggcggcggactcggctgcggccgtcgccgatctcggcgcg
gtgctggaggcgcaacgcctgcgcacgcccgaacaggtacgccgggtacgcgcccacgac
cagtgggaggacaacgtcttccccttcgccggcgacctgctgggcgcctcgttcgacaag
gaacgcctgccgctgacccggagtttcttcaaccgcgcccaggaaaacctggtcgaggtg
ctgatgccggcgaagaagcacttcgcccgcccgcgtccctacgaagtgacaccgaaggtg
aagccggtgctgccgccgccggagggggagtcctatcccagcggccacaccatggacagc
tacttcaaggcctcgctgctgagcatgctggtgccggagcatcacgatgcgttcttcgcc
cgcgccgaggagcatgcgcagagccgtgtgctggccggcgtgcacttccccagcgacctg
gaaggcgggcagaccgccgccgcggcgctggtggcgagcctgctggccgatccggcggtg
gccgccgacttcgccgcggtgcgcgaggagctgcgcggcgcgctggggttgccgaaactc
cagtag

DBGET integrated database retrieval system