KEGG   Pseudomonas aeruginosa PAO1: PA0260
Entry
PA0260            CDS       T00035                                 

Name
(RefSeq) hypothetical protein
Organism
pae  Pseudomonas aeruginosa PAO1
SSDB
Motif
Pfam: DUF3274 Abhydrolase_1 Abhydrolase_8 DUF900 Lipase_3
Other DBs
NCBI-GeneID: 879499
NCBI-ProteinID: NP_248951
UniProt: Q9I6M9
Position
complement(291154..293304)
AA seq 716 aa
MNDRVRSRTIVSAQSITLPKGGDVHLVPPPPKPCVTIVVHGVNDLAGCYERIERGLCQGL
NERLDMPPTLPGGQANPGYLTPAGYSLPADDEGKAENPDVVYYRRKFASGAGGAAVRSVV
VPFYWGFREEEQYINKTAAHGEWLDRNGNRLDKSGTKEGGQFVNATTNLPDMWGQGFNGK
LFGFISLDWFGGTMTHPLFSAAGRKYMVLAAMRLAMLIKIIRKRYPDDTINVVGHSQGTL
LTLLAHAFLKDDGVAPADGVIMLNSPYGLFEPLNEKLQGWSSQQTREARLATLKGILEFI
CGRRHPVPALSSVALRNCQGYGAIGGPGWVGGQGCQTTIDGERLSFDERDNRGSVYLYFT
PQDQTVGLANVQGIGWRGIAEQVKGLPGRTGLPQGFHQRIFTVRKRNGEKEKIGGHAPPH
VYPLLLAGEKTWEDTGLGGKDRFGRANFDQGDSVLLTAPRLPLPTEARFDFDGAVTAPGE
NSASGVYQVRDTLDPIDAAIGVSNGGWKEKDSGHAVAQQVDAALAYRYGRDARSVERALN
EGKELAQQTHVFSARELGTGMVLVTRAETPYEARLRLQTAEGHLEPLSFHSAIPNNPEHN
RRVLAYDLAIGAGDSVDDVVFYQYLCRVADWRLDWKASDKGIFSQGDASVDLPDEEVRAL
YRAEESKNSQLIDATVAYRKSGEFPVVVGNRLPSLVGTQTILDRYHEQAVRFGGTI
NT seq 2151 nt   +upstreamnt  +downstreamnt
atgaacgatagggttcggtcgaggacgatcgtctctgcccagtccatcaccttgcccaag
ggcggcgacgtgcacctggtgccgcctccgcccaagccttgcgtgaccatcgtggtgcat
ggcgtcaacgatctcgcgggttgctacgaacggatcgagcgagggctctgccaggggctc
aatgaacgcctggacatgccgccgaccttgcccggcgggcaggccaatcccggctacctg
acgccggcgggctacagcctgccggcggacgacgaaggcaaggcagagaaccccgacgtc
gtctactaccggcgcaagttcgccagtggcgccggcggggccgccgtacgcagcgtagtc
gtacctttctactggggcttccgcgaggaagagcaatacatcaacaagaccgcggcccac
ggcgaatggctggaccgcaacggcaaccggctggacaagtccggcaccaaggaaggcggg
cagttcgtcaatgccaccaccaacctgccggacatgtggggccagggtttcaacggcaag
ctgttcggtttcatctcgctggactggttcggcggcaccatgacccatccgctgttttcg
gcggcagggcgcaagtacatggtccttgcggccatgcgcctggccatgttgatcaagatc
atccgcaagcgttacccggacgacaccatcaatgtcgtcgggcacagccagggcaccctg
ttgaccctgctggcacatgccttcctcaaggatgacggcgtggcgccggcggacggggtg
atcatgctcaactcaccctacggcctgttcgaacccctcaacgagaagctccagggctgg
agcagccagcagaccagagaggcgcggctggccacgctcaaaggtatcctcgagttcatc
tgcggccgacgccatccggtccccgcgctgagcagcgtcgcgttgcgcaactgccaaggc
tacggcgcgataggcggccccggctgggtgggtggccagggctgccagacgaccatcgac
ggggaacggctcagcttcgatgagcgcgacaatcgcggcagtgtctacctgtatttcacg
ccccaggaccagacggtgggacttgccaacgtccagggtatcggctggcgcggcattgct
gagcaggtcaaggggctcccgggaaggaccgggctgccgcagggttttcaccagcgcatc
ttcaccgtacgcaagcgcaatggcgagaaggaaaagatcggcgggcacgcccctccccat
gtctatcctcttctgctggccggcgagaagacctgggaagacaccgggctgggcggcaag
gacagattcggccgggcgaacttcgaccagggcgacagcgtgctgctgactgcgccgcgt
ctgccgttgccgacggaagcgcgattcgatttcgacggagccgtcacggcgccgggagag
aactccgccagcggcgtctatcaggtgcgcgataccctcgatccgatcgacgccgccatc
ggcgtaagcaacggcggctggaaggaaaaggacagcgggcacgccgtcgcgcaacaggtg
gacgccgcgctggcgtaccgctacgggcgcgacgcgcgcagcgtggagagggcgttgaac
gaaggcaaggaattggcccagcagacccatgtgttttccgctcgtgaactgggcaccggc
atggttctggtcacccgcgcggaaactccctacgaggcccggctgcgcctgcagacggcg
gagggccatctggagcccttgtcgttccactcggccatacccaacaacccggagcataac
cggcgggtactggcctatgacctggccatcggggccggggacagcgtggatgatgtggtt
ttctatcagtatctgtgtcgggtggcggattggcggttggattggaaggcttcggacaaa
ggaatatttagtcaaggtgatgcgtctgttgatctgccggatgaagaggtgcgtgctttg
taccgtgcggaagagtctaaaaacagccagttaatagacgccaccgtagcttaccgcaag
agtggcgagttccctgtggtagtaggaaatagactgccttccctagtcgggacacaaacc
atcctagatcgttaccacgagcaggcggtgcgctttggggggacaatctaa

DBGET integrated database retrieval system