KEGG   Pseudomonas aeruginosa PAO1: PA0373Help
Entry
PA0373            CDS       T00035                                 

Gene name
ftsY
Definition
(RefSeq) signal recognition particle receptor FtsY
  KO
K03110  fused signal recognition particle receptor
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
pae02024  Quorum sensing
pae03060  Protein export
pae03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pae00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    PA0373 (ftsY)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PA0373 (ftsY)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    PA0373 (ftsY)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pae02044]
    PA0373 (ftsY)
Secretion system [BR:pae02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   PA0373 (ftsY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SRP54 SRP54_N Zeta_toxin AAA_30 AAA_22 AAA_33 AAA_17 AAA_31 MeaB APS_kinase AAA AAA_16 AAA_18 CbiA MMR_HSR1 DUF2075 AAA_14 ABC_tran AAA_24 Thymidylate_kin AAA_19 NACHT AAA_7 Fer4_NifH PIF1 Viral_helicase1 Rad17 AAA_3 ATP_bind_1 NTPase_1 ArsA_ATPase
Motif
Other DBs
NCBI-GeneID: 883018
NCBI-ProteinID: NP_249064
UniProt: Q9I6C1
Position
417527..418894
Genome map
AA seq 455 aa AA seqDB search
MFGSNDDKKAPQGGEKKGLFGWWRKKPQAGEQPADQPVEPVSETAAAEQRAPADDVAQSL
TEQPGRQQPSAAEPAEPPAPVAEAPLAGDEPASAEEHSPRPEAPVAQPEPILAAEPEPEP
EPEPEPEPEPVAPLAAAPAVSEPATRPGFFARLRQGLSKTSASIGEGMASLFLGRKEIDD
DLLDDIETRLLTADVGVEATTLIVQNLTKRVARKELADSGALYKALQEELASLLRPVEQP
LQVDVAREPYVILVVGVNGVGKTTTIGKLAKKLQLEGKKVMLAAGDTFRAAAVEQLQVWG
ERNRIPVIAQHTGADSASVIFDAVQAAKARGIDVLIADTAGRLHTKDNLMEELKKVRRVI
GKLDETAPHEVLLVLDAGTGQNAINQAKQFNLAVELTGLALTKLDGTAKGGVIFALAKQF
GLPIRYIGVGEGIDDLRTFEADAFVQALFAERENA
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgtttggttccaacgacgacaagaaggccccgcagggcggggaaaagaaaggtctgttc
ggctggtggcggaaaaagccgcaagccggcgagcagcctgccgatcagcctgtcgagccg
gtctccgagacagcggccgccgagcagcgcgcgcctgccgatgacgtggcgcaatccctg
acagaacagccaggtcggcagcagccctccgctgccgagccggccgagccgccggcgccg
gttgccgaagcgccgctcgccggtgacgagccagcgtcggccgaggagcattcgccccgc
cccgaggcgcccgtcgcacaacccgagcctatcctcgctgccgagcccgagcccgagccc
gagcccgagcccgagcccgagcccgagcccgttgcgccgctggccgccgctccggcagtc
agcgagccggcgaccaggccgggcttcttcgcccgcctccggcagggactgtccaagacc
agcgccagcatcggcgaaggcatggccagcctgttcctcggccgcaaggaaatcgacgac
gacctgctcgacgacatcgagacgcgcctgctgaccgccgacgtcggcgtcgaggccacc
accctgatcgtgcagaacctgaccaagcgcgtggcgcgcaaggagctggccgacagcggc
gcgctgtacaaggcgctgcaggaagagctggccagcctgctgcgcccggtggagcagccg
ttgcaggtcgacgtcgcgcgcgagccctatgtgatcctggtggtcggggtgaacggcgtg
ggcaagaccaccaccatcggcaagctggcgaagaagctgcaactcgagggcaagaaggtc
atgctggccgccggcgacaccttccgcgccgccgccgtggagcagttgcaggtctggggc
gagcgcaaccgcatcccggtgatcgcccagcacaccggcgccgactccgcctcggtgatc
ttcgacgcggtgcaggccgccaaggcccgcggcatcgacgtgctgatcgccgataccgcc
ggacgcctgcataccaaggacaacctgatggaggagctgaagaaggtgcgccgggtgatc
ggcaagctggacgagacggcgccccatgaggtcctgctggtgctcgacgccggcaccggg
cagaacgccatcaaccaggccaagcagttcaacctcgcggtggagctgaccggcctggcc
ctgaccaaactggacggcaccgccaagggcggggtgatcttcgccctggccaagcagttc
ggcctgccgatccgctatatcggtgtcggcgaggggatcgacgatctccgtaccttcgag
gccgacgccttcgtccaggcactcttcgcagagcgggagaacgcatga

DBGET integrated database retrieval system