KEGG   Pseudomonas aeruginosa PAO1: PA0402
Entry
PA0402            CDS       T00035                                 

Gene name
pyrB
Definition
(RefSeq) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
pae00240  Pyrimidine metabolism
pae00250  Alanine, aspartate and glutamate metabolism
pae01100  Metabolic pathways
pae01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:pae00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    PA0402 (pyrB)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PA0402 (pyrB)
Enzymes [BR:pae01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     PA0402 (pyrB)
SSDB
Motif
Pfam: OTCace_N OTCace
Other DBs
NCBI-GeneID: 878267
NCBI-ProteinID: NP_249093
UniProt: Q59653
Position
complement(444687..445691)
AA seq 334 aa
MPTDAKRPLQLNDQGQLRHFISLDGLPRELLTEILDTADSFLEVGARAVKKVPLLRGKTV
CNVFFENSTRTRTTFELAAQRLSADVISLNVSTSSTSKGETLTDTLRNLEAMAADMFVVR
HSDSGAAHFIAEHVSPNVAVINGGDGRHAHPTQGMLDMLTIRRHKGNFEQLSVAIVGDIL
HSRVARSNMLALKTLGCPDIRVIAPRTLLPIGLEEQYGVRVFTNADEGLKDVDVVIMLRL
QRERMQGGLLPSEGEFFKLYGLTEKRLKLAKPDAIVMHPGPINRGVEIESAVADGAQSVI
LNQVTYGIAIRMAVLSMAMSGQNTQRQLEQEDAE
NT seq 1005 nt   +upstreamnt  +downstreamnt
atgccgacagacgccaagcgcccgctgcagctcaacgaccagggccagctgcgccacttc
atctcgctcgacggattgccccgcgagctgctcaccgaaatcctcgataccgccgattcc
ttcctggaggtcggcgcccgcgcggtgaaaaaggtcccgctgctgcgcggcaagaccgtc
tgcaacgtgttcttcgagaactccacgcgcacccgcaccaccttcgagctggccgcccag
cggctgtcggccgacgtgatcagcctgaacgtatccacctcttccaccagcaagggcgag
acgctcaccgacaccctgcgcaacctggaggcgatggccgccgacatgttcgtggtgcgc
cacagcgactcgggcgcggcgcacttcatcgccgagcacgtcagccccaacgtggcggtg
atcaacggcggcgacggacgccacgcgcaccccacccaggggatgctcgacatgctgacc
atccgccggcacaaagggaacttcgagcagctatcggtggcgatcgtcggcgatatcctg
cattcgcgagtagcccgttcgaacatgctggcgctcaagaccctgggttgcccggacatc
cgcgtgatcgccccgcgcaccctcttgccgatcggcctggaagagcagtacggcgtgcgc
gtgttcaccaacgccgacgaaggcctgaaggacgtcgacgtggtgatcatgctgcgcctg
caacgcgagcgcatgcagggtggcctgctacccagcgagggcgagttcttcaagctctac
ggcctgaccgagaagcgcctgaagctggccaagccggatgccatcgtcatgcaccctggc
ccgatcaaccgtggcgtggagatcgagtcggcggtggccgacggggcccagtcggtgatc
ctcaaccaggtcacctacggcatcgccatccgcatggcggtgctgtccatggccatgagc
ggccagaacacccaacgccagctggaacaggaggacgccgaatga

DBGET integrated database retrieval system