KEGG   Pseudomonas aeruginosa PAO1: PA0426
Entry
PA0426            CDS       T00035                                 

Gene name
mexB
Definition
(RefSeq) multidrug resistance protein MexB
  KO
K18138  multidrug efflux pump
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
pae01501  beta-Lactam resistance
pae01503  Cationic antimicrobial peptide (CAMP) resistance
Module
pae_M00718  Multidrug resistance, efflux pump MexAB-OprM
Brite
KEGG Orthology (KO) [BR:pae00001]
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    PA0426 (mexB)
   01503 Cationic antimicrobial peptide (CAMP) resistance
    PA0426 (mexB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pae02000]
    PA0426 (mexB)
   01504 Antimicrobial resistance genes [BR:pae01504]
    PA0426 (mexB)
Transporters [BR:pae02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   PA0426 (mexB)
Antimicrobial resistance genes [BR:pae01504]
 Gene sets
  Multipdrug resistance modules
   Multidrug resistance, efflux pump MexAB-OprM [MD:M00718]
    PA0426 (mexB)
SSDB
Motif
Pfam: ACR_tran SecD_SecF
Other DBs
NCBI-GeneID: 877852
NCBI-ProteinID: NP_249117
UniProt: P52002
Structure
PDB: 

Position
473191..476331
AA seq 1046 aa
MSKFFIDRPIFAWVIALVIMLAGGLSILSLPVNQYPAIAPPAIAVQVSYPGASAETVQDT
VVQVIEQQMNGIDNLRYISSESNSDGSMTITVTFEQGTDPDIAQVQVQNKLQLATPLLPQ
EVQRQGIRVTKAVKNFLMVVGVVSTDGSMTKEDLSNYIVSNIQDPLSRTKGVGDFQVFGS
QYSMRIWLDPAKLNSYQLTPGDVSSAIQAQNVQISSGQLGGLPAVKGQQLNATIIGKTRL
QTAEQFENILLKVNPDGSQVRLKDVADVGLGGQDYSINAQFNGSPASGIAIKLATGANAL
DTAKAIRQTIANLEPFMPQGMKVVYPYDTTPVVSASIHEVVKTLGEAILLVFLVMYLFLQ
NFRATLIPTIAVPVVLLGTFGVLAAFGFSINTLTMFGMVLAIGLLVDDAIVVVENVERVM
AEEGLSPREAARKSMGQIQGALVGIAMVLSAVFLPMAFFGGSTGVIYRQFSITIVSAMAL
SVIVALILTPALCATMLKPIEKGDHGEHKGGFFGWFNRMFLSTTHGYERGVASILKHRAP
YLLIYVVIVAGMIWMFTRIPTAFLPDEDQGVLFAQVQTPPGSSAERTQVVVDSMREYLLE
KESSSVSSVFTVTGFNFAGRGQSSGMAFIMLKPWEERPGGENSVFELAKRAQMHFFSFKD
AMVFAFAPPSVLELGNATGFDLFLQDQAGVGHEVLLQARNKFLMLAAQNPALQRVRPNGM
SDEPQYKLEIDDEKASALGVSLADINSTVSIAWGSSYVNDFIDRGRVKRVYLQGRPDARM
NPDDLSKWYVRNDKGEMVPFNAFATGKWEYGSPKLERYNGVPAMEILGEPAPGLSSGDAM
AAVEEIVKQLPKGVGYSWTGLSYEERLSGSQAPALYALSLLVVFLCLAALYESWSIPFSV
MLVVPLGVIGALLATSMRGLSNDVFFQVGLLTTIGLSAKNAILIVEFAKELHEQGKGIVE
AAIEACRMRLRPIVMTSLAFILGVVPLAISTGAGSGSQHAIGTGVIGGMVTATVLAIFWV
PLFYVAVSTLFKDEASKQQASVEKGQ
NT seq 3141 nt   +upstreamnt  +downstreamnt
atgtcgaagtttttcattgataggcccattttcgcgtgggtgatcgccttggtgatcatg
ctcgcgggcggcctgtcgatcctcagtctgccggtcaaccagtacccggccatcgccccg
ccggccatcgccgtgcaggtgagctacccgggcgcctcggccgagacggtgcaggacacc
gtggtccaggtgatcgagcagcagatgaacgggatcgacaatctgcgctacatctcctcg
gagagtaactccgacggcagcatgaccatcaccgtgaccttcgaacagggcaccgacccc
gacatcgcccaggtccaggtgcagaacaagctgcaactggccaccccgctactgccgcag
gaagtgcagcgccaggggatccgggtgaccaaggcggtgaagaacttcctcatggtggtc
ggtgtggtttccaccgacggcagcatgaccaaggaagacctgtcgaactacatcgtttcc
aacatccaggacccactctcgcggaccaagggcgtcggtgacttccaggtgttcggctcg
cagtactcgatgcgcatctggctcgacccggccaagctgaacagctaccagctgaccccc
ggcgacgtgagcagcgcgatccaggcgcagaacgtgcagatttcctccggccagctcggc
ggcttgccggcggtcaagggccagcagctcaacgccaccatcatcggcaagacccgcctg
cagaccgcggagcaattcgagaacatcctgctcaaggtcaatcccgacggttcccaggtg
cgcctgaaggacgtcgccgatgtaggcctgggcggccaggactacagcatcaacgcgcag
ttcaacggcagcccggcgtccggtatcgcgatcaagctggccaccggcgccaacgcgctg
gataccgccaaggcgatccgccagaccatcgccaacctggaaccgttcatgccgcagggc
atgaaggtggtctacccgtacgacaccaccccggtggtctcggcctcgatccatgaggta
gtgaagaccctcggcgaggcgatcctcctcgtgttcctggtgatgtacctgttcctgcag
aacttccgcgccacgctgatcccgaccatcgccgtaccggtggtgctgctggggaccttc
ggcgtgctcgccgcgttcggcttctcgatcaacaccctgaccatgttcggcatggtgctg
gccatcggcttgctggtggacgacgccatcgtggtggtggagaacgtcgagcgggtgatg
gccgaggaaggcctgtcgccaagggaggcggcgcgcaagtccatgggccagatccagggc
gcgctggtcggtatcgccatggtgctctcggcggtattcctgccgatggcgttcttcggc
ggctccaccggggtgatctaccggcagttctccatcaccatcgtgtcggccatggccctc
tcggtgatcgtggcgctgatcctcaccccggcgctctgcgcgaccatgctcaagccgatc
gagaaaggcgaccatggcgagcacaagggcggcttcttcggctggttcaaccggatgttc
ctttccaccacccacggctacgagcggggcgtggcgtcgatcctcaagcatcgcgcgccg
tacctgctgatctacgtggtgatcgtggccgggatgatctggatgttcacccgcattccc
accgcgttcctccccgacgaggaccagggcgtactgttcgcccaggtacagaccccgccg
ggctccagtgccgagcgtacccaggtggtggtggactcgatgcgcgaatacctgctggag
aaggaaagctcttcggtcagctcggtgttcaccgtgaccggcttcaacttcgccggccgc
ggccagagttcgggcatggcgttcatcatgctcaagccctgggaagagcgtcccggtggc
gagaacagcgtgttcgaactggccaagcgcgcgcagatgcacttcttcagcttcaaggac
gcgatggtgttcgccttcgcgccgccgtcggtactggaactgggtaacgccaccggcttc
gacctgttcctccaggaccaggcgggtgtcggccacgaagtcctgctccaggcgcgcaac
aagttcctcatgctcgccgcgcagaacccggcgctgcaacgcgtgcgccccaacggcatg
agcgacgaaccgcagtacaagctggagatcgacgacgagaaggccagcgccctcggcgtg
tcccttgccgacatcaacagcaccgtgtccatcgcctggggttccagctacgtcaacgat
ttcatcgaccgtggccgggtcaagcgggtctacctgcagggcaggccggacgcgcggatg
aacccggacgacctgagcaagtggtacgtgcgcaacgacaagggcgagatggtgccgttc
aacgccttcgccaccggcaagtgggaatacggttcgccgaagctggagcgctacaatggc
gtgccggcgatggagatcctcggcgagccggcgcccggcctgagttccggtgacgccatg
gcggcggtcgaggagatcgtcaagcaattgccgaaaggcgttggctactcctggaccggc
ctgtcctacgaggagcgcttgtccggctcgcaggcgccggcgctgtatgcgctgtcgctg
ctggtggtgttcctctgcctggcggccctgtacgaaagctggtcgattccgttctcggtg
atgctggtggtgccgttgggcgtgatcggtgcgctgctggcgacgtccatgcgcggcctg
tccaacgacgtgttcttccaggtgggcctgttgacgaccatcggcctgtcggcgaagaac
gccattctcatcgtggagttcgccaaggagctgcacgagcagggcaagggcatcgtcgag
gcggccatcgaagcctgccgcatgcgtctgcggccgatcgtgatgacctccctggcgttc
atcctcggcgtggtcccgctggcgatctccaccggcgccggctcgggcagccagcatgcg
atcggtaccggcgtgatcggcggcatggtcactgcgaccgtcctggcgatcttctgggta
ccgctgttctacgtggcggtcagcacgctgttcaaggacgaggcgtccaagcagcaggcg
tccgtcgaaaaggggcaatga

DBGET integrated database retrieval system