KEGG   Pseudomonas aeruginosa PAO1: PA0482Help
Entry
PA0482            CDS       T00035                                 

Gene name
glcB
Definition
(RefSeq) malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
pae00620  Pyruvate metabolism
pae00630  Glyoxylate and dicarboxylate metabolism
pae01100  Metabolic pathways
pae01110  Biosynthesis of secondary metabolites
pae01120  Microbial metabolism in diverse environments
pae01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pae00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PA0482 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    PA0482 (glcB)
Enzymes [BR:pae01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     PA0482 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-GeneID: 879477
NCBI-ProteinID: NP_249173
PathoGenesis: PA0482
UniProt: Q9I636
Structure
PDB: 

Position
complement(542170..544347)
Genome map
AA seq 725 aa AA seqDB search
MTERVQVGGLQVAKVLFDFVNNEAIPGTGVSADTFWTGAEAVINDLAPKNKALLAKRDEL
QAKIDGWHQARAGQAHDAVAYKAFLEEIGYLLPEAEDFQAGTQNVDDEIARMAGPQLVVP
VMNARFALNASNARWGSLYDALYGTDVISEEGGAEKGKGYNKVRGDKVIAFARAFLDEAA
PLESGSHVDATSYSVKNGALVVALKNGSETGLKNAGQFLAFQGDAAKPQAVLLKHNGLHF
EIQIDPSSPVGQTDAAGVKDVLMEAALTTIMDCEDSVAAVDADDKVVIYRNWLGLMKGDL
AEEVSKGGSTFTRTMNPDRVYTRADGSELTLHGRSLLFVRNVGHLMTNDAILDKDGNEVP
EGIQDGLFTSLIAIHDLNGNTSRKNSRTGSVYIVKPKMHGPEEAAFTNELFGRVEDVLGL
PRNTLKVGIMDEERRTTVNLKACIKAAKDRVVFINTGFLDRTGDEIHTSMEAGAVVRKGA
MKSEKWIGAYENNNVDVGLATGLQGKAQIGKGMWAMPDLMAAMLEQKIGHPLAGANTAWV
PSPTAATLHALHYHKVDVFARQAELAKRTPASVDDILTIPLAPNTNWTAEEIKNEVDNNA
QGILGYVVRWIDQGVGCSKVPDINDVGLMEDRATLRISSQLLANWLRHGVISQEQVVESL
KRMAVVVDRQNASDPSYRPMAPNFDDNVAFQAALELVVEGTRQPNGYTEPVLHRRRREFK
AKNGL
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgactgaacgcgttcaagtcggtggcctgcaggtcgccaaagtcctgttcgacttcgtg
aacaacgaagccatccccggaaccggcgtctctgccgacacgttctggaccggtgcggag
gccgtgatcaacgacctggcgccgaagaataaagccctgctcgccaagcgcgacgaactc
caggccaagatcgacggctggcaccaggctcgcgccggccaggcccacgacgcagttgcc
tacaaggccttcctcgaggaaatcggctacctgctgcccgaggcggaagacttccaggcc
ggcacccagaacgtcgacgacgagatcgcccgcatggccggcccgcagctggtggtgccg
gtgatgaatgcgcgcttcgccctcaacgcctccaacgcccgctggggctcgctgtacgac
gcactctacggcaccgacgtgatcagcgaagaaggcggcgccgagaaaggcaagggctac
aacaaggttcgcggcgacaaggtcatcgccttcgctcgcgccttcctcgacgaggccgcg
ccgctggagtccggctcccatgtcgacgccacttcctacagcgtgaagaacggcgcgctg
gtcgtcgcgctgaagaacggcagcgaaaccggcctgaagaatgctggccagttccttgcc
ttccagggcgacgccgccaagccgcaagcggtactgctcaagcacaacggcctgcacttc
gaaatccagatcgacccgagcagcccggtcggccagaccgatgccgcaggcgtgaaggac
gtgctgatggaagccgccctcaccaccatcatggactgcgaggactcggtcgccgcggtc
gacgccgacgacaaggtagtgatctaccgcaactggctgggcctgatgaaaggcgacctg
gccgaggaagtcagcaagggcggcagcaccttcacccgcaccatgaacccggaccgcgtc
tacaccagggccgacggttccgaactgaccctgcacggccgctcgctgctgttcgtgcgc
aacgtcggccacctgatgaccaacgatgcgatcctcgacaaggacggcaacgaagtgccg
gaaggcatccaggacggtctgttcaccagcctgatcgccattcatgacctgaacggcaac
accagccgcaagaacagccgcaccggcagcgtgtatatcgtcaagccgaagatgcacggt
ccggaagaagccgccttcaccaacgagctgttcggccgcgtcgaggacgtcctcggcctg
ccgcgcaacaccctgaaggtcggcatcatggacgaggagcgccgcaccaccgtgaacctg
aaggcctgcatcaaggcggccaaggatcgcgtggtgttcatcaacaccggcttcctcgac
cgcaccggcgacgagatccacacctccatggaagccggcgccgtggtgcgcaagggcgcc
atgaagtcggagaagtggatcggcgcctacgagaacaacaacgtcgacgtcggcctggcc
accggcctgcaaggcaaggcgcagatcggcaagggcatgtgggccatgcccgacctgatg
gccgccatgctcgagcagaagatcggccatccgctggccggcgccaacaccgcctgggtc
ccgtcgccgaccgccgcgaccctgcacgccctgcattaccacaaggtcgacgtgttcgcc
cgccaggccgagctggccaagcgcaccccggcctcggtggacgacatcctgaccattccg
ctggcgccgaacaccaactggaccgcggaagagatcaagaacgaggtggacaacaacgcc
cagggcatcctcggctatgtcgtccgctggatcgaccagggcgtcggctgctccaaggtg
ccggacatcaacgacgtcggtctgatggaagaccgcgccaccctgcgcatctccagccaa
ctgctggccaactggctgcgtcacggcgtgatcagccaggagcaggtggtcgagagcctc
aagcgcatggccgtggtggtcgaccggcagaacgccagcgacccgtcctaccggccgatg
gcgccgaacttcgacgacaacgtcgcgttccaggccgccctggagctggtggtggaaggc
acccggcagccgaacggctataccgagccggtcctgcatcgccgccgccgtgagttcaag
gcgaagaacgggctgtag

DBGET integrated database retrieval system