KEGG   Pseudomonas aeruginosa PAO1: PA0507Help
Entry
PA0507            CDS       T00035                                 

Definition
(RefSeq) acyl-CoA dehydrogenase
Organism
pae  Pseudomonas aeruginosa PAO1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyl-CoA_dh_C Acyl-CoA_dh_1 Acyl-CoA_dh_M Acyl-CoA_dh_N AcylCoA_DH_N Acyl-CoA_dh_2
Motif
Other DBs
NCBI-GeneID: 878181
NCBI-ProteinID: NP_249198
UniProt: Q9I611
Position
566932..568728
Genome map
AA seq 598 aa AA seqDB search
MPEYKAPLRDMRFLIDEVFDFHGRYQALGASDATPDMVAAILDEGSKFCEQVLAPLNRSG
DEEGCHFDNGVVTTPKGFKEAYAQYVEGGWNGVASDPAYGGQGLPHSLGLLLSEMIGASN
VSWGMYPGLTRGAMSAIHAHGSQAQKDLYLARMTAGTWTGTMCLTEPHCGTDLGIIKTRA
VPNADGSHAISGTKIFISAGEHDLSENIVHLVLAKLPDAPAGTKGISLFIVPKFLPDAEG
NVGARNAVSCGSIEHKMGIKASATCVMNFDGATGYLIGEPNKGLHCMFTMMNHARLGTGM
QGLCLGETSYQGAVRYARERLQMRSLTGPKAPDKPADPIIVHPDVRRMLLTMKAFNEGNR
ALAYFTAQLLDTEHLSQDAAERERAADLLAFLTPICKAFMTETGQEVTNLGMQVYGGHGY
IREWGMEQLVRDCRIAQIYEGTNGIQALDLLGRKVLGSQGKLLRGFTKLVHQLCQAQAEH
PQLKGQVAQLAALNAQWGELTQQVGLAAMKNADEVGAASVDYLMFSGYVTLAYFWLRIAL
VAREKLDAGSGEAAFYEAKLATADFYFSRLLPRTAAHAAAIQAGAAGLMSLSAEQFSL
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atgccggaatacaaggctccgctgcgcgacatgcgcttcctgatcgatgaggtattcgac
ttccatgggcgctaccaggcgctcggcgccagcgacgcgaccccggacatggtggcggcg
atcctcgatgaagggtcgaaattctgcgaacaggttctggcgccgctgaaccgctccggc
gacgaagagggctgccacttcgacaacggcgtggtgaccacgcccaagggtttcaaggaa
gcctatgcacagtacgtcgagggtggctggaacggtgtcgccagcgatcccgcgtacggc
ggccagggcctgccgcactcgctgggtctgctgctcagcgagatgatcggcgccagcaat
gtctcctggggcatgtacccgggcctgacccgcggcgccatgtcggcgatccacgcccac
ggcagccaggcgcagaaggacctctacctggcgcggatgaccgccggcacctggaccggc
accatgtgcctgaccgagccgcactgcggcaccgacctgggcatcatcaagacccgcgcg
gtgccgaacgccgacggcagccatgcgatcagcgggacgaagatattcatctccgccggc
gagcacgacctgagcgagaacatcgtccacctggtgctggccaagcttcccgatgcgccg
gccgggaccaagggtatctcgctgttcatcgtgccgaagttccttcccgacgccgaaggt
aacgtgggcgcgcgcaatgcggtctcctgtggctccatcgagcacaagatggggatcaag
gcctcggccacctgtgtgatgaacttcgacggcgccaccggctacctgatcggcgagccg
aacaagggcctgcactgcatgttcaccatgatgaaccacgcccgcctgggcaccggcatg
cagggcctgtgccttggcgagaccagctaccagggcgccgtgcgctacgcccgggagcgc
ttgcagatgcgctcgctgacggggccgaaggcgccggacaagccggccgacccgatcatc
gtgcaccccgacgtacggcgcatgctgctgaccatgaaggcgttcaacgaaggcaaccgc
gcgctggcctacttcaccgcccagttgctcgacaccgagcacctgtcgcaggacgccgcc
gagcgcgagcgggccgccgacctgctggccttcctgacaccgatctgcaaggccttcatg
accgagaccgggcaggaggtgaccaacctcggcatgcaggtctacggcggccacggctac
atccgcgagtggggcatggagcagttggtccgcgattgccgcatcgcacagatctacgaa
ggcaccaacggcatccaggccctcgacctgcttggccgcaaggtactgggcagccagggc
aagctgttgcgcggtttcaccaaactggtccaccagttgtgccaggcccaggccgagcat
ccgcaactgaagggacaggtcgcgcaactggcggcgctgaacgcgcagtggggcgaactg
acccagcaggtgggcctggcggcgatgaagaatgccgacgaagtgggcgccgcctcggtg
gactacctgatgttctccggctacgtgaccctggcctatttctggttgcgcatcgccctg
gtggcgcgcgagaagctggatgccggcagcggcgaggccgcgttctacgaagccaagctg
gccaccgccgacttctacttcagtcgcctgctgccgcgcaccgcggcgcacgccgcggcg
atccaggccggcgcggcgggcctgatgagcctgtcggcggagcagttttcgctctag

DBGET integrated database retrieval system