KEGG   Pseudomonas aeruginosa PAO1: PA0683Help
Entry
PA0683            CDS       T00035                                 

Definition
(RefSeq) type II secretion system protein
  KO
K02461  general secretion pathway protein L
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
pae03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pae00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PA0683
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pae02044]
    PA0683
Secretion system [BR:pae02044]
 Type II secretion system
  General secretion pathway protein
   PA0683
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GspL_C DUF3563
Motif
Other DBs
NCBI-GeneID: 880821
NCBI-ProteinID: NP_249374
UniProt: Q9I5P2
Position
740203..741348
Genome map
AA seq 381 aa AA seqDB search
MFAPGCARRGAGTNRGLARGTGAAAPGVAGGAVPASARLPPGQSRTAGAACGEACRRGEL
RGRGAGPRRSGAVRLAHGPRGADGRLTLEWLEASALASLEQAVQRLRLDVREVQAAPFLL
PLRDDAWVAGEWDGHLLLRRSLSDAVVHPLPEQGLAEVPQELRLFWLGERPAWRSAALER
AEALDEALRWSGPASPWGLALKAPATSAGNGTWKMPLFCAALALLVWVAGLNLYAGQLAE
QGQSLQRQSSQRVQQAFPELPVVLDPLRQARERRDAYLAGKADGDAAPGLAALLHGAGEA
MPFLAGRLQRLDYHAGELDLELLPGLPGGDAAAWQGELGKHGLQADASDKGWQVRAMEAP
PAPAAGAADSGTAEAAADEDE
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
ttgtttgcgcctggatgcgcgcggcgcggtgcaggaacgaatcgaggtctcgctcgcgga
actggcgcggcggcgccaggggttgccggtggcgctgttcctgcatccgcgcgattgccg
cctggtcagtctcgaactgccggcgctgcctgcggcgaagcttgccgccgcggtgaactg
cgcggccgaggcgctggtcctcggcgatccggcgcagtacgcctggcccacggcccgcgc
ggcgccgacgggcgcctgaccttggagtggctggaggcgtcggcgctggcctcgctggag
caggccgtacagcggctgcggctcgacgtgcgggaggtgcaggccgcgccgttcctcctg
ccgttgcgcgatgacgcttgggtggccggcgagtgggacggtcatctgctgttgcgccgc
tcgctgagcgacgctgtggtccatcccttgccggagcagggcctcgctgaggtcccgcag
gagttgcggctgttctggctgggcgagcgaccggcgtggcgctctgcagccctggagcgg
gccgaggcgctggacgaagcgctgcgctggagcgggcccgccagtccgtggggattggcg
ctgaaagcgccggcgacgagcgccggcaacggcacctggaagatgcccctgttctgcgct
gccctggccttgctggtgtgggtcgccggtctgaacctgtacgccgggcaactggccgag
cagggccagtccttgcaacggcagagcagtcaacgcgtgcagcaggccttcccggaactg
ccggtggtgctcgatccgctgcgccaggctcgcgagcgacgcgacgcctatctggccggc
aaggccgatggcgatgccgcaccgggactggccgcgctgctgcatggcgccggcgaggcg
atgccgttcctcgccgggcgcctgcaacgactggactaccacgccggcgaactggacctg
gagctgctgccgggactgccaggcggcgatgccgctgcctggcagggcgagttgggcaag
cacgggttgcaggccgatgcctccgacaagggctggcaggtgcgcgccatggaagcgccg
ccagcgccggccgctggcgcggcagacagtggcactgccgaggcggctgccgatgaagat
gaataa

KEGG   Pseudomonas aeruginosa PAO1: PA3096Help
Entry
PA3096            CDS       T00035                                 

Gene name
xcpY
Definition
(RefSeq) type II secretion system protein L
  KO
K02461  general secretion pathway protein L
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
pae03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pae00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PA3096 (xcpY)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pae02044]
    PA3096 (xcpY)
Secretion system [BR:pae02044]
 Type II secretion system
  General secretion pathway protein
   PA3096 (xcpY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T2SSL GspL_C
Motif
Other DBs
NCBI-GeneID: 882778
NCBI-ProteinID: NP_251786
UniProt: P25060
Structure
PDB: 

Position
complement(3476482..3477630)
Genome map
AA seq 382 aa AA seqDB search
MSGVSALFLPPASTAGADGELAVWWVQDGECRRAPFAQALAEIRAPWRLYLPVEAVTACA
VNLPTQKARWLRQSLPFAVEEQLADDVEQMHLALGPALADGRHRVFAVQRTWLAAWLALA
EGAGKAPASLHVDADCLPGEGSCLFWLEERWLLGGSGAVRLACGSEDWPVLRDSCPPPQR
AFAAQEVAPLEGVEVQALAGNPHVWLSEQPLGTDLAQAEFAARQQSSQWRRWRPLLGLVG
LWLVLQWGFTLVQAWQLQREGDRYAAQSAELYRQLFPEDRKLINLRAQFDQHLADSASSG
GEGQLLGLLGQAATVIGGEPTVSVEQLDFSAARGDVALQVRAPGFDVLERLRSRLSESGL
AVQLGSASRDGSTVSARLVIGG
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgagtggagtgagtgcgctgttcctgccgcccgccagcacggcgggggccgatggggaa
ctggcggtatggtgggtgcaggatggcgagtgccggcgcgcgccgttcgcccaggcgctg
gcggagatccgcgcgccctggcggctgtacctgccggtggaggcggtgaccgcctgcgcg
gtgaacctgcctacacagaaggcgcgctggttgcgccagtcgctgccgttcgcggtggag
gaacaactggccgacgatgtcgagcagatgcaccttgcccttggtccggcgctggccgac
ggccgccaccgggtattcgccgtgcagcgcacctggctcgccgcctggctggcgctggcc
gagggcgcgggcaaggcgccggcttcgctgcatgtcgatgccgattgcctgccgggcgag
ggcagttgcctgttctggctggaagagcgctggttgctcggcggcagcggcgccgtacgc
ctggcctgcggcagcgaggattggccggtactgcgcgacagttgcccgccgccgcagcgg
gccttcgccgcgcaggaggtggcgcccctggagggggtggaagtccaggccctggcgggc
aatccgcacgtctggctgagcgagcagccgctgggcaccgacctggcccaggccgagttc
gccgcgcgccagcagagcagccagtggcgccgctggcggccgctgctggggttggtcggg
ctgtggttggtattgcaatggggcttcaccctggtccaggcctggcagttgcagcgcgaa
ggcgaccgctacgcggcgcagagcgcagaactctaccgccagttgtttcccgaggaccgc
aagctgatcaacctgcgcgcgcagttcgaccagcacctggccgacagcgccagcagcggc
ggcgagggccagttgctcggcctgcttggccaggccgccacggtgatcggcggcgagccg
acggtgagcgtcgagcaactggacttcagcgccgctcgcggcgacgtcgccctccaggtg
cgggctcccggtttcgacgtgctggaacggctgcgttcgcgtctcagcgagtccgggctg
gcggtgcagctgggttcggccagccgcgatggctcgacggtcagcgcgcgcctggtgata
ggaggttga

DBGET integrated database retrieval system