KEGG   Pseudomonas aeruginosa PAO1: PA0821
Entry
PA0821            CDS       T00035                                 
Name
(RefSeq) hypothetical protein
Organism
pae  Pseudomonas aeruginosa PAO1
SSDB
Motif
Pfam: DUF3396
Other DBs
NCBI-GeneID: 878355
NCBI-ProteinID: NP_249512
UniProt: Q9I5B8
Structure
Position
complement(897335..898423)
AA seq 362 aa
MEQPFDLAAELAKQPHLLEIAGNLLMKSGPEDYIGAVLCLRGTLYFKKAHTPLVRESLCQ
CFDEFERLAEPHLTWLWREEPAQGKPLTAYRDTQPLREMMGAMDEDDHLSFCYTSGKKSR
DAGAWLFDIYGKRSWQAKMGHDLSVLEFSVPLLYQERQPLDFLQLFIDFARRLEPEQGYA
GHAYNLSPTSWDNDEPSEAFMAARMPGLDVGTACLLANTPEFKPTRIKTVSWLTLLNNER
LALAGGLDALRAQLPSSHFAFYRYGDGVVIQAGAYPYIAGDAEDSRPAPYVLLNHALKGI
RYETIGSLHGGSHDGELRLVGWAADQWLKRLDVEDSEIPRWCDKLLSAEPYLDATNTLPE
RL
NT seq 1089 nt   +upstreamnt  +downstreamnt
atggaacagccattcgatctggctgcagagttagccaagcaaccccatctactggaaata
gccggcaacctgttgatgaagagcggccccgaagactatatcggtgctgtgctttgccta
cgcggcactctctacttcaaaaaggcccataccccactggtacgtgagtcattatgccaa
tgcttcgatgagttcgagcgcctggcagagcctcacctcacctggctctggcgtgaagag
cctgcacaaggaaagccactgaccgcataccgtgacacccaaccactgcgcgagatgatg
ggggcaatggatgaagacgatcatctcagcttctgctacaccagcggcaagaaatcccgc
gatgcaggcgcctggctgtttgatatttacggcaagcggagctggcaagccaaaatgggg
catgatcttagtgttctggagttctccgtacctctgctatatcaagagcggcagccattg
gatttcctacagctgtttattgacttcgcacggcgactagagccggagcaggggtatgcg
gggcatgcctacaatctctcgccgaccagttgggacaatgacgagccctccgaagccttt
atggcggcgcgtatgccgggtttggatgtagggacggcttgtctgctggccaatactccc
gagttcaaacctacaagaatcaaaactgtcagttggctaaccctcctgaacaacgagcgc
ctggcgctggccggcgggctcgatgccctgcgtgcgcaactgccctccagccactttgcc
ttctaccgctacggcgatggcgtggtaatccaggccggtgcctatccctatatcgcgggt
gatgcggaagactccaggcccgctccgtatgtgctgctgaaccacgcgctcaaaggcatt
cgctatgaaaccatcggctcgctacacggcggctcccacgacggcgaattgcggctggtg
ggctgggcggccgatcaatggctgaaacggctggatgtggaagacagcgagattccccgg
tggtgcgacaaactgctcagcgctgagccttacctggacgcgacgaatacgctgccggag
cgcctgtag

DBGET integrated database retrieval system