KEGG   Pseudomonas aeruginosa PAO1: PA0841Help
Entry
PA0841            CDS       T00035                                 

Definition
(RefSeq) hypothetical protein
Organism
pae  Pseudomonas aeruginosa PAO1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DegV
Motif
Other DBs
NCBI-GeneID: 882002
NCBI-ProteinID: NP_249532
UniProt: Q9I599
Position
916346..917305
Genome map
AA seq 319 aa AA seqDB search
MRIGLVVDATCDLPPEFLAAHGIRVMPIGIRLGEQRLIDRRDPDTTLSFYRDHLPKVGSK
DGSQPLSAAELQQWFLDELVTDFDYVVCLTVDSLRSPIFEHATQASFGLLQHYHERRHAA
GIAGPFTLRVLDSHSVFAGIACLAAEGTRLLAQGSHPNALRTRLEQLSQQTCTYLVADDL
GHLRRRGFQKGDRSGFVDRVKGAALGLGSLLDVKPVFSLADGEDKPVALSPSFEKSAEKL
FGYALARVQAGELLAPQLGLSYAGDPTALRDLPGFAALENACRERDIHLHLGMLSPTGGI
NLGAGAMSLGFIATPKAFA
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgcgtatcggcctggtggtcgacgcgacctgcgacctgccgcccgaattcctcgccgcc
cacggcatccgcgtgatgccgatcgggatccgcctgggcgagcagcggctcatcgatcga
cgcgaccccgacaccaccctgagcttttaccgcgaccacctgcccaaggtcggtagcaag
gacggcagccagccgctctccgccgccgagttgcaacaatggttcctcgacgaactggtg
accgacttcgactacgtggtctgcctcaccgtcgacagcctgcgcagtccgatcttcgag
cacgccacccaggcctccttcggcctgctccagcactaccacgagcgccgccacgcggcc
ggcatcgccggtcccttcaccctgcgcgtactcgacagccactcggtgttcgccggcatc
gcctgcctggcggccgagggcacgcgcctgctggcgcagggcagccaccccaacgcgctg
cgtacgcgcctcgaacagctcagccagcagacctgcacctacctggtcgccgatgacctg
ggccacttgcgccggcgcggcttccagaagggtgatcgcagcggtttcgtcgaccgggtc
aagggcgcagcgctggggttgggctcgctgctcgacgtcaagccggtgttcagcctggcc
gatggcgaggacaaaccggtggcgctctcgccgagcttcgagaagtcggcggagaagctg
ttcggctatgccctggcgcgggtacaggcgggtgagctgctggcaccgcaactgggtctc
agctatgccggcgatccgaccgcgctgcgcgacctgccgggcttcgccgcgctggagaac
gcctgccgcgagcgcgacatccacttgcacctgggcatgctcagccctaccggcggcatc
aatctgggcgccggggccatgagcctgggcttcatcgccacgccgaaagcctttgcctga

DBGET integrated database retrieval system