KEGG   Pseudomonas aeruginosa PAO1: PA1003
Entry
PA1003            CDS       T00035                                 

Gene name
mvfR
Definition
(RefSeq) transcriptional regulator MvfR
  KO
K19735  LysR family transcriptional regulator, quorum-sensing system regulator MvfR
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
pae02024  Quorum sensing
pae02025  Biofilm formation - Pseudomonas aeruginosa
Brite
KEGG Orthology (KO) [BR:pae00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    PA1003 (mvfR)
   02025 Biofilm formation - Pseudomonas aeruginosa
    PA1003 (mvfR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pae03000]
    PA1003 (mvfR)
Transcription factors [BR:pae03000]
 Prokaryotic type
  Helix-turn-helix
   LysR family
    PA1003 (mvfR)
SSDB
Motif
Pfam: LysR_substrate HTH_1
Other DBs
NCBI-GeneID: 879994
NCBI-ProteinID: NP_249694
UniProt: Q9I4X0
Structure
PDB: 
4JVC 6B8A 4JVI 4JVD

Position
complement(1086097..1087095)
AA seq 332 aa
MPIHNLNHVNMFLQVIASGSISSAARILRKSHTAVSSAVSNLEIDLCVELVRRDGYKVEP
TEQALRLIPYMRSLLNYQQLIGDIAFNLNKGPRNLRVLLDTAIPPSFCDTVSSVLLDDFN
MVSLIRTSPADSLATIKQDNAEIDIAITIDEELKISRFNQCVLGYTKAFVVAHPQHPLCN
ASLHSIASLANYRQISLGSRSGQHSNLLRPVSDKVLFVENFDDMLRLVEAGVGWGIAPHY
FVEERLRNGTLAVLSELYEPGGIDTKVYCYYNTALESERSFLRFLESARQRLRELGRQRF
DDAPAWQPSIVETAQRRSGPKALAYRQRAAPE
NT seq 999 nt   +upstreamnt  +downstreamnt
atgcctattcataacctgaatcacgtgaacatgttcctccaggtcatcgcctccggttcg
atttcctccgctgcgcggatcctgcgcaagtcgcacaccgcggtcagctcggcggtcagc
aacctggaaatcgacctgtgcgtggagctggtccgtcgggacggctacaaggtcgaaccc
accgagcaggcgcttcgcctgatcccttacatgcgcagcctgctgaactaccagcagctg
atcggcgacatcgccttcaatctcaacaagggtccgcgcaatctccgggtgctgctggac
accgccatcccgccgtcgttctgcgatacggtgagcagcgtactgctcgacgatttcaac
atggtcagcctgatacgcacctcgcccgccgatagcctggcgacgatcaagcaggacaac
gcggaaatcgatatcgccatcaccatcgacgaggaactgaagatctcccgcttcaaccag
tgcgtgctcggctacaccaaggcgttcgtcgtcgcccatccgcagcacccgttgtgcaat
gcctccctgcacagcatcgcgagcctggccaattaccggcagatcagcctcggcagccgc
tccgggcagcattcgaacctgctgcggccggtcagcgacaaggtgctcttcgtggaaaac
ttcgacgacatgctgcgtctggtggaagccggcgtcggatggggcatcgcgccgcattat
ttcgtcgaggaacgcctgcgcaacggtaccctggcagtcctcagcgaactctacgaaccg
ggcggcatcgacaccaaggtgtattgctactacaacaccgcgctggaatccgagcgcagc
ttcctgcgctttctcgaaagcgcccgccagcgcctgcgcgaactcggccgccagcgtttc
gacgatgcgccggcctggcaaccgagcatcgtcgaaacggcgcagcgccgctcaggcccg
aaggcgctcgcgtaccgccagcgcgccgcaccagagtag

DBGET integrated database retrieval system