KEGG   Pseudomonas aeruginosa PAO1: PA1041
Entry
PA1041            CDS       T00035                                 

Definition
(RefSeq) hypothetical protein
Organism
pae  Pseudomonas aeruginosa PAO1
SSDB
Motif
Pfam: OmpA Gly-zipper_Omp Gly-zipper_YMGG Pilus_CpaD Gly-zipper_OmpA
Other DBs
NCBI-GeneID: 881756
NCBI-ProteinID: NP_249732
UniProt: Q9I4T3
Position
1126969..1127601
AA seq 210 aa
MSITRTALPLILVSGLLTGCAGLQKSDWPTCAAVGGVTGAGLGAIESSSWAGWGALIGGG
VGAAYCWVHGAGEQVAPPPPQPVEEVAPPPPVVKEETIVVRDLHFAFDSSKVDAADSEKL
NGIAERLKGEAASTRLSITGHTDSVGSDAYNQKLSERRANAVANYLIDAGVPSSIIVGVQ
GLGESQPVADNKTREGRAENRRVEILIKRE
NT seq 633 nt   +upstreamnt  +downstreamnt
atgagcatcacgaggaccgctttacccctgattctggtcagcggcttgctgaccggttgc
gcagggttgcagaaaagcgactggccgacctgtgcggcggtcggtggtgttaccggcgcc
ggcctgggcgcgatcgaaagcagcagctgggccggctggggcgccctgatcggcggtggc
gtcggtgccgcctattgctgggtgcacggtgccggcgaacaggtcgcgccgccgcctccg
cagccggtcgaggaagtcgcgccgccgcctcccgtcgtcaaggaagaaaccattgtcgtg
cgcgacctgcacttcgccttcgattcgtcgaaggtggacgccgccgacagcgagaagctc
aacggcatcgccgaacgcctgaaaggcgaggcggccagtacgcgcctgagtatcaccggg
cataccgacagcgtcggttccgatgcctacaaccagaagctgtcggaacggcgcgcgaat
gccgttgcgaactatctgatcgatgccggggtgccttcgagcatcatcgtcggcgtgcag
ggattgggcgaaagccagccggtcgccgacaacaagactcgcgaagggcgggccgagaat
cgccgggtggaaatcctcatcaagcgcgaatga

DBGET integrated database retrieval system