KEGG   Pseudomonas aeruginosa PAO1: PA1148Help
Entry
PA1148            CDS       T00035                                 

Gene name
toxA
Definition
(RefSeq) exotoxin A
  KO
K11020  exotoxin A [EC:2.4.2.-]
Organism
pae  Pseudomonas aeruginosa PAO1
Brite
KEGG Orthology (KO) [BR:pae00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:pae02042]
    PA1148 (toxA)
Enzymes [BR:pae01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.-  
     PA1148 (toxA)
Bacterial toxins [BR:pae02042]
 Type III toxins: Intracellular toxins
  ADP-ribosyltransferase
   Exototoxin-A (ETA)
    PA1148 (toxA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Exotox-A_bind Exotox-A_cataly Exotox-A_target
Motif
Other DBs
NCBI-GeneID: 877850
NCBI-ProteinID: NP_249839
UniProt: P11439
Structure
PDB: 

Position
complement(1240584..1242500)
Genome map
AA seq 638 aa AA seqDB search
MHLTPHWIPLVASLGLLAGGSFASAAEEAFDLWNECAKACVLDLKDGVRSSRMSVDPAIA
DTNGQGVLHYSMVLEGGNDALKLAIDNALSITSDGLTIRLEGGVEPNKPVRYSYTRQARG
SWSLNWLVPIGHEKPSNIKVFIHELNAGNQLSHMSPIYTIEMGDELLAKLARDATFFVRA
HESNEMQPTLAISHAGVSVVMAQAQPRREKRWSEWASGKVLCLLDPLDGVYNYLAQQRCN
LDDTWEGKIYRVLAGNPAKHDLDIKPTVISHRLHFPEGGSLAALTAHQACHLPLETFTRH
RQPRGWEQLEQCGYPVQRLVALYLAARLSWNQVDQVIRNALASPGSGGDLGEAIREQPEQ
ARLALTLAAAESERFVRQGTGNDEAGAASADVVSLTCPVAAGECAGPADSGDALLERNYP
TGAEFLGDGGDISFSTRGTQNWTVERLLQAHRQLEERGYVFVGYHGTFLEAAQSIVFGGV
RARSQDLDAIWRGFYIAGDPALAYGYAQDQEPDARGRIRNGALLRVYVPRSSLPGFYRTG
LTLAAPEAAGEVERLIGHPLPLRLDAITGPEEEGGRLETILGWPLAERTVVIPSAIPTDP
RNVGGDLDPSSIPDKEQAISALPDYASQPGKPPREDLK
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atgcacctgacaccccattggatccccctggtcgccagcctcggcctgctcgccggcggc
tcgttcgcgtccgccgccgaggaagccttcgacctctggaacgaatgcgccaaggcctgc
gtgctcgacctcaaggacggcgtgcgttccagccgcatgagcgtcgacccggccatcgcc
gacaccaacggccagggcgtgctgcactactccatggtcctggagggcggcaacgacgcg
ctcaagctggccatcgacaacgccctcagcatcaccagcgacggcctgaccatccgcctc
gaaggtggcgtcgagccgaacaagccggtgcgctacagctacacgcgccaggcgcgcggc
agttggtcgctgaactggctggtgccgatcggccacgagaagccttcgaacatcaaggtg
ttcatccacgaactgaacgccggtaaccagctcagccacatgtcgccgatctacaccatc
gagatgggcgacgagttgctggcgaagctggcgcgcgatgccaccttcttcgtcagggcg
cacgagagcaacgagatgcagccgacgctcgccatcagccatgccggggtcagcgtggtc
atggcccaggcccagccgcgccgggaaaagcgctggagcgaatgggccagcggcaaggtg
ttgtgcctgctcgacccgctggacggggtctacaactacctcgcccagcagcgctgcaac
ctcgacgatacctgggaaggcaagatctaccgggtgctcgccggcaacccggcgaagcat
gacctggacatcaagcccacggtcatcagtcatcgcctgcatttccccgagggcggcagc
ctggccgcgctgaccgcgcaccaggcctgccacctgccgctggagaccttcacccgtcat
cgccagccgcgcggctgggaacaactggagcagtgcggctatccggtgcagcggctggtc
gccctctacctggcggcgcggctgtcgtggaaccaggtcgaccaggtgatccgcaacgcc
ctggccagccccggcagcggcggcgacctgggcgaagcgatccgcgagcagccggagcag
gcccgtctggccctgaccctggccgccgccgagagcgagcgcttcgtccggcagggcaca
ggcaacgacgaggccggcgcggccagcgccgacgtggtgagcctgacctgcccggtcgcc
gccggtgaatgcgcgggcccggcggacagcggcgacgccctgctggagcgcaactatccc
actggcgcggagttcctcggcgacggcggcgacatcagcttcagcacccgcggcacgcag
aactggacggtggagcggctgctccaggcgcaccgccaactggaggagcgcggctatgtg
ttcgtcggctaccacggcaccttcctcgaagcggcgcaaagcatcgtcttcggcggggtg
cgcgcgcgcagccaggacctcgacgcgatctggcgcggtttctatatcgccggcgatccg
gcgctggcctacggctacgcccaggaccaggaacccgacgcgcgcggccggatccgcaac
ggtgccctgctgcgggtctatgtgccgcgctcgagtctgccgggcttctaccgcaccggc
ctgaccctggccgcgccggaggcggcgggcgaggtcgaacggctgatcggccatccgctg
ccgctgcgcctggacgccatcaccggccccgaggaggaaggcgggcgcctggagaccatt
ctcggctggccgctggccgagcgcaccgtggtgattccctcggcgatccccaccgacccg
cgcaacgtcggcggcgacctcgacccgtccagcatccccgacaaggaacaggcgatcagc
gccctgccggactacgccagccagcccggcaaaccgccgcgcgaggacctgaagtaa

DBGET integrated database retrieval system