KEGG   Pseudomonas aeruginosa PAO1: PA1234Help
Entry
PA1234            CDS       T00035                                 

Definition
(RefSeq) hypothetical protein
Organism
pae  Pseudomonas aeruginosa PAO1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thioredoxin_9 Thioredoxin_7
Motif
Other DBs
NCBI-GeneID: 881198
NCBI-ProteinID: NP_249925
PathoGenesis: PA1234
UniProt: Q9I4A4
Structure
PDB: 

Position
complement(1334950..1335453)
Genome map
AA seq 167 aa AA seqDB search
MASYAELFDIGEDFAAFVGHGLATEQGAVARFRQKLESNGLPSALTERLQRIERRYRLLV
AGEMWCPDCQINLAALDFAQRLQPNIELAIISKGRAEDDLRQRLALERIAIPLVLVLDEE
FNLLGRFVERPQAVLDGGPQALAAYKAGDYLEHAIGDVLAIIEGAAR
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atggcctcttacgcggaactgttcgatatcggagaagacttcgccgccttcgtcggccat
ggcctggccacggaacagggcgcggtcgcgcggttccggcagaagctggaaagcaacggg
ctgccgagcgccctgacggaacgcctgcaacgcatcgaacggcgctatcgcctgctggtc
gccggggaaatgtggtgcccggactgccagatcaacctggccgcgctggacttcgcgcag
cgcctgcaaccgaacatcgagctggcgatcatttccaagggccgcgccgaggacgacctg
cgccagcgcctggcgctggagcgaatcgcgattccgctggtactggtgctggacgaggag
ttcaacctgctcggacgcttcgtcgaacggccgcaggcggtgctcgacggcggtccgcag
gcgcttgcggcgtacaaggcgggcgactacctggagcacgccatcggcgacgtcctggcg
atcatcgaaggcgcggcgcgctga

DBGET integrated database retrieval system