KEGG   Pseudomonas aeruginosa PAO1: PA1274
Entry
PA1274            CDS       T00035                                 

Definition
(RefSeq) 5,6-dimethylbenzimidazole synthase
  KO
K04719  5,6-dimethylbenzimidazole synthase [EC:1.13.11.79]
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
pae00740  Riboflavin metabolism
pae01100  Metabolic pathways
pae01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:pae00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    PA1274
Enzymes [BR:pae01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.79  aerobic 5,6-dimethylbenzimidazole synthase
     PA1274
SSDB
Motif
Pfam: Nitroreductase
Other DBs
NCBI-GeneID: 881430
NCBI-ProteinID: NP_249965
UniProt: Q9I470
Position
1385670..1386326
AA seq 218 aa
MSDSSHAFSATERAAVYRAIAERRDMRHFSGGSVAPELLARLLEAAHQAPSVGLMQPWRF
IRITEPALRRAIHGLVEEERGRTAEALGERSDEFMRLKVEGVLDCAELLVAALMDDRERH
VFGRRTLPQMDLASLACAIQNLWLASRAEGLGMGWVSLFDPAALGELLGLPPGSEAVAVL
CLGPVAEFYPAPMLALEGWSEPRPLAELVYQNRWGERA
NT seq 657 nt   +upstreamnt  +downstreamnt
atgtccgattcttcccacgccttcagcgccacggagcgcgccgccgtctaccgggccatc
gccgagcgccgcgacatgcgccacttcagcggtggcagcgtggcgccggagctgctcgcg
cggctgctggaggccgcacaccaggcgcccagcgtcggcctgatgcaaccctggcgcttc
atccgtatcaccgagccggcgttgcggcgggccatccacgggctggtcgaggaggaacgc
ggacgcaccgccgaagccctcggcgagcgctccgacgagttcatgcggctcaaggtcgag
ggcgtgctggattgcgccgaactgctggtcgccgccctgatggacgaccgcgaacgccat
gtgttcggtcgccggaccctgccgcagatggacctggcgtcgctcgcctgcgcgatccag
aacctctggctggccagtcgcgccgagggcctggggatgggctgggtatcgctgttcgat
ccggccgcgctgggcgagttgctcggcctgccgcccggcagcgaggcggtggcggtgctc
tgcctgggcccggtggcggagttctacccggcgccgatgctggcgctggagggttggagc
gaaccgcgtccgctggccgagctggtctaccagaaccgttggggcgagcgagcatga

DBGET integrated database retrieval system