KEGG   Pseudomonas aeruginosa PAO1: PA1296Help
Entry
PA1296            CDS       T00035                                 

Definition
(RefSeq) 2-hydroxyacid dehydrogenase
Organism
pae  Pseudomonas aeruginosa PAO1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C IlvN NAD_binding_7 NAD_binding_2 TrkA_N Shikimate_DH ThiF ApbA Pyr_redox AdoHcyase_NAD
Motif
Other DBs
NCBI-GeneID: 881526
NCBI-ProteinID: NP_249987
UniProt: Q9I448
Position
1407007..1407939
Genome map
AA seq 310 aa AA seqDB search
MRLLILERDHALYAALLMAADPSLKVVAGDDPLQLIDAASECSIWLGQPDLVAQMLRQGV
HPVWVQSTWAGITPLLAADLPKDYSLTRAVGIFGQVMSEYLLTYMLAHERQFLGRLASQV
GSQWDSRTPGGLRGRQVVIVGTGEIGQAVAHTLSGFGMDLTGVAKNPRSLVPFNRMGSLD
DLGRLVETADYLINLLPDTPDTHDIYDRALFARLKPTALFINAGRGVAVVDADLVAALEN
NQLAGAVIDVCREEPLPANHLFWHTPRLLLTGHTAAPTLPGAMVELFRDNLARFWAGTAM
RGEVDFARGY
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgcgcttgctgattctcgaacgtgaccacgctctctatgccgcgctgctgatggcggcc
gaccccagcctgaaggtggtggcgggggacgatcccctgcagctcatcgacgccgccagc
gagtgctcgatctggctcggccagcccgacctggtggcgcagatgctgcgccagggcgtg
catccggtctgggtgcagtcgacctgggcgggcatcacgccgctgctggccgccgacctg
ccgaaggactacagcctgacacgcgcggtaggcatcttcggccaggtgatgagcgaatac
ctgctgacctacatgctcgcccacgagcgccagttcctcggtcgcctggccagccaggtc
ggttcgcaatgggatagccgcacgcctggcgggttgcgtggccggcaggtggtgatcgtg
ggcaccggggagatcggccaggcggtggcgcataccctgtccggcttcggcatggacctg
accggggtggcgaagaatccgcgttcgctggtgccgttcaaccgcatggggtcgctcgac
gacctcggtcgcctggtggagacggccgactacctgatcaacctgctgcccgacaccccc
gatacccacgacatctacgaccgtgcgctgttcgcccggctcaagcccacggcgctgttt
atcaatgccgggcgtggtgtcgcggtggtggacgccgacctggtggcggcactggagaac
aaccaactggccggcgcggtgatcgacgtctgccgcgaagagccgctgccggccaaccac
ctgttctggcataccccgcgcctcttgctgaccgggcacaccgccgcgccgaccctgccg
ggggcgatggtcgaactgttccgcgacaacctcgcgcgcttctgggcgggtaccgccatg
cgcggcgaggtggacttcgctcgcggctactga

DBGET integrated database retrieval system