KEGG   Pseudomonas aeruginosa PAO1: PA1375Help
Entry
PA1375            CDS       T00035                                 

Gene name
pdxB
Definition
(RefSeq) erythronate-4-phosphate dehydrogenase
  KO
K03473  erythronate-4-phosphate dehydrogenase [EC:1.1.1.290]
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
pae00750  Vitamin B6 metabolism
pae01100  Metabolic pathways
Module
pae_M00124  Pyridoxal biosynthesis, erythrose-4P => pyridoxal-5P
Brite
KEGG Orthology (KO) [BR:pae00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    PA1375 (pdxB)
Enzymes [BR:pae01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.290  4-phosphoerythronate dehydrogenase
     PA1375 (pdxB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C DUF3410 2-Hacid_dh XdhC_C TrkA_N
Motif
Other DBs
NCBI-GeneID: 881132
NCBI-ProteinID: NP_250066
UniProt: Q9I3W9
Structure
PDB: 

Position
1491913..1493055
Genome map
AA seq 380 aa AA seqDB search
MRILADENIPVVDAFFADQGSIRRLPGRAIDRAALAEVDVLLVRSVTEVSRAALAGSPVR
FVGTCTIGTDHLDLDYFAEAGIAWSSAPGCNARGVVDYVLGCLLAMAEVRGADLAERTYG
VVGAGQVGGRLVEVLRGLGWKVLVCDPPRQAREPDGEFVSLERLLAEADVISLHTPLNRD
GEHPTRHLLDEPRLAALRPGTWLVNASRGAVVDNQALRRLLEGGADLEVALDVWEGEPQA
DPELAARCLIATPHIAGYSLEGKLRGTAQIYQAYCAWRGIAERVSLQDVLPETWLAGLQL
NPGCDPAWALATLCRAVYDPRSDDAAFRRSLTGDSATRRAAFDALRKHYPPRREITGLRV
ATGGQAELQRVVRALGAQLV
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgcgtattctcgccgatgaaaacattcccgtggtcgacgccttcttcgccgaccagggc
tccattcgccgcttgcccgggcgcgccatcgaccgcgcggcgctggccgaggtcgacgtg
ctgctggtgcgctcggtcaccgaggtcagccgcgcggcgctggccggctcgccggtgcgc
ttcgtcggcacctgcaccatcggcaccgaccacctcgacctcgactacttcgccgaggcc
ggcatcgcctggtccagcgcacccggctgcaacgcccgcggggtggtggactacgtgctc
ggctgcctgctggcgatggccgaggtgcgcggcgccgacctggccgaacgcacctatggg
gtggtcggcgccgggcaggtcggcgggcggctggtggaggtgctgcgcgggctgggctgg
aaagtgctggtctgcgatccgccgcgccaggcacgcgagccggacggcgaattcgtctcg
ctggaacggctgctggccgaggccgacgtgatcagcctgcacactccgctgaaccgcgac
ggcgaacacccgacccgccacctgctggatgagccccgcctggccgccctgcgtcccggc
acctggctggtcaacgccagccgtggcgcggtggtcgacaaccaggccctgcgccgcctg
ctcgaaggcggcgccgacctggaagtggcgctggacgtctgggaaggcgaaccgcaggcc
gaccccgaactggccgcgcgctgcctgatcgccacgccgcacatcgccggctacagcctg
gaaggcaagctgcgcggcaccgcacagatctaccaggcctactgcgcctggcgcggcatc
gccgaacgcgtgagcctgcaagacgtgctgccggaaacctggctcgccggcctgcaactc
aaccccggctgcgacccggcctgggcgctggccacgctgtgccgcgcggtgtacgacccg
cgcagcgacgacgccgccttccgccgcagcctgaccggcgacagcgccacccgccgcgcc
gccttcgacgccctgcgcaaacactacccgccgcgccgcgagatcaccggcctgcgcgtc
gccaccggtggacaggcggagttgcagcgggtggtgcgggcgctgggggcgcagttggtc
tag

DBGET integrated database retrieval system