KEGG   Pseudomonas aeruginosa PAO1: PA1657Help
Entry
PA1657            CDS       T00035                                 

Definition
(RefSeq) hypothetical protein
  KO
K11901  type VI secretion system protein ImpB
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
pae02025  Biofilm formation - Pseudomonas aeruginosa
Brite
KEGG Orthology (KO) [BR:pae00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    PA1657
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pae02044]
    PA1657
Secretion system [BR:pae02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PA1657
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_VipA
Motif
Other DBs
NCBI-GeneID: 879559
NCBI-ProteinID: NP_250348
UniProt: Q9I368
Position
1805218..1805724
Genome map
AA seq 168 aa AA seqDB search
MAKEGSVAPKERINVTFKPATGGAQEEIELPLKLLAIGDYTQRADERKVEDRKPIGIDKM
TFDEVLAKQELGLTLSVPNRLQEEGGSDELAVGLQINSMKDFNPASIVEQVPELKKLMEL
RDALVALKGPLGNAPAFRKAIESVLADDESRSRVLGELGLSAAPSQDA
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atggccaaagaaggctcggtagccccaaaggaacgcatcaacgtcaccttcaagcccgcc
actggcggtgcccaggaagaaatcgaactgccgttgaagctactggcgatcggcgattac
acccagcgcgcggatgagcgcaaggtggaggaccgcaagccgatcggcatcgacaagatg
accttcgacgaggtcctggccaagcaggagctggggctgacgctgagcgtacccaatcgt
ctccaggaggagggcggcagcgacgagctggcggtggggctgcagatcaactcgatgaag
gacttcaacccggccagcatcgtcgagcaggtgcccgagctgaagaagctgatggagttg
cgcgatgcgttggtggccctcaagggcccgctgggcaacgccccggcgttccgcaaggcc
atcgaaagcgtactcgccgacgacgagtcccgtagccgtgtgctgggcgagctggggctg
agcgccgccccctcccaggacgcctga

DBGET integrated database retrieval system