KEGG   Pseudomonas aeruginosa PAO1: PA1660
Entry
PA1660            CDS       T00035                                 

Definition
(RefSeq) hypothetical protein
  KO
K11896  type VI secretion system protein ImpG
Organism
pae  Pseudomonas aeruginosa PAO1
Brite
KEGG Orthology (KO) [BR:pae00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pae02044]
    PA1660
Secretion system [BR:pae02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PA1660
SSDB
Motif
Pfam: T6SS_TssF
Other DBs
NCBI-GeneID: 880603
NCBI-ProteinID: NP_250351
UniProt: Q9I365
Position
1808193..1809773
AA seq 526 aa
MMHLLWPNYMRPLPAFSILQFDPLTRPGGALRVERDTPVESRPVGEVACRFRTCYATEVL
PLVLEALNYSVTGEGALLGLRLAMNCDGHLGELGLSRLRLHLAGERYISQMLYLCLLRNL
ESIQLIPLDAHGRPLDGVAGKPMSFRLTGERVQPVGFAEDEALIPYPLNTFRGYRYLQEY
FAFQDKFLFVDVDGLDLLGALPEETLKQVRGLELRFDIRKSGIQRLHPTLENVKLYCTPV
ANLFRHDALPIRLDGKQDEYLLMPAEYSLEDCGVFSVEGVTGWRPGGLGYQAYVPFESFE
HDPSFDVPEARPHYSVRQRTSLLHDGLDTYLSFGIRHPEQIETLSVELTCTNQNLPQRLR
LGDICVACEGTPEFLGFRNITPATPSYAPPLNRDFLWKLISNMSLNYLSLANVDALKVIL
ETYDLPRYYDQHAAKVSKRLLGGLKAVRHEHVDRLHRGLPLRGLRTELTIDPEGYIGEGD
LFVFASVLNEFFALYASINSYHELRVRSTQGDVYQWKPRMGLQPLL
NT seq 1581 nt   +upstreamnt  +downstreamnt
atgatgcacctgctgtggccgaactatatgcgcccgctgccggctttcagcattctccag
ttcgaccccctgacccgcccgggcggggcgctgcgcgtggagcgcgatacgccggtcgag
agccggccggtgggcgaggtcgcctgtcgcttccgtacctgctacgccaccgaagtcctg
ccgctggtgctggaggcgctcaactattcggtgaccggcgagggtgcgctgctcggcctg
cgcctggcgatgaactgcgacgggcatctcggcgagctgggcctgagtcggctgcgcctg
cacctggccggcgagcgctacatcagccagatgctctacctgtgcctgctgcgcaacctg
gagagcatccagctgattccgctggacgcccatgggcggccgctggatggcgtggccggc
aagccgatgtcgttccgcctgacgggcgagcgggtgcagccggtggggttcgccgaagac
gaggcgttgattccctatccgctgaataccttccgtggctatcgctacctgcaggaatac
ttcgcgttccaggacaagttcctgttcgtcgacgtggatggccttgacctgctcggcgcg
ctgcccgaggaaaccctcaagcaggtccgcggcctcgagttgcgcttcgatatccgcaag
agcggcatccagcgcctgcacccgacgctggagaacgtcaagctgtactgtacgccggtg
gccaacctgttccgccacgatgcgctgccgatccgcctcgacggcaagcaggacgagtac
ctgctgatgccggccgaatacagcctggaggactgcggggtgttctcggtagagggcgtc
accggctggcggccgggcgggctcggctaccaggcctatgtgccgttcgagtccttcgag
cacgatcccagcttcgacgtcccggaagcacggccccactacagcgtccggcaacggacc
tcgttgctgcacgatggcctggacacctacctgagcttcggcatccgccatcccgagcag
atcgagacgctgtcggtggaactgacctgcaccaaccagaacctgccccaacggctgcgc
ctgggcgatatctgcgtcgcttgcgaaggtacgccggagttcctcggtttccgcaatatc
accccggcgacgccgagctacgcgccgccgctgaaccgcgatttcctctggaaactgatc
agcaacatgtcgctcaactacctgtcgctggccaacgtcgacgcactcaaggtgatcctc
gaaacctacgacctgccgcgctactacgaccagcatgcggcgaaggtcagcaagcgcctg
ctgggcgggctcaaggcggtccgccacgagcatgtcgaccgcctgcatcggggcctgccg
ctgcgcggcttgcgtaccgagctgacgatcgatccggaaggctacatcggcgagggcgac
ctgttcgtgttcgcttcggttctgaacgaatttttcgcgctttacgccagcatcaactcc
taccacgagttgcgggtgaggagcacacagggagacgtgtaccaatggaaaccgcgcatg
ggtttgcagcccctgctgtaa

DBGET integrated database retrieval system