KEGG   Pseudomonas aeruginosa PAO1: PA1693Help
Entry
PA1693            CDS       T00035                                 

Gene name
pscR
Definition
(RefSeq) type III secretion system protein
  KO
K03226  type III secretion protein R
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
pae03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pae00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PA1693 (pscR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pae02044]
    PA1693 (pscR)
Secretion system [BR:pae02044]
 Type III secretion system
  Type III secretion core apparatus
   PA1693 (pscR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FliP UNC-93 OppC_N
Motif
Other DBs
NCBI-GeneID: 879755
NCBI-ProteinID: NP_250384
UniProt: Q9I334
Position
complement(1842568..1843221)
Genome map
AA seq 217 aa AA seqDB search
MIQLPDELGLILGLALLALVPFIAVMATSFIKMTVVFSLLRNALGVQQIPPNMAMYGLAI
ILSLYVMAPVGFATRDYLRNHDVSLSDSASVERFLDEGMAPYRNFLKRQIQEREHTFFME
STRQVWPSEYAERLDPDSLLILLPAFTVSELTRAFEIGFLIYLPFIAIDLIISNILLAMG
MMMVSPMTISLPFKLLLFVLLDGWARLTHGLVISYGG
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgatccagttgcccgacgagctcggcctgatcctcggcctggccctgctcgcgctggtc
ccgttcatcgcggtgatggcgacctccttcatcaagatgaccgtggtattctcgctgctg
cgcaacgccctgggcgtccagcagattccgccgaacatggcgatgtacgggctggcgatc
atcctcagcctgtacgtgatggcaccggtcggcttcgccacccgcgactacctgcgcaac
cacgacgtcagcctgagcgactcggcatcggtggaacgctttctcgacgagggcatggcg
ccctaccggaacttcctcaagcggcagatccaggagcgcgaacacaccttcttcatggaa
agcacccgccaggtctggcccagcgaatacgccgagcggctcgacccggacagcctgctg
atcctgctgccggccttcaccgtcagcgaactgacccgtgcgttcgagatcggcttcctg
atctacctgcccttcatcgccatcgacctgatcatctccaacatcctcctggcgatgggc
atgatgatggtgtcgccgatgaccatttccctgccgttcaagctgctcctgttcgtcctc
ctcgacggctgggcgcggctgacccacggcctggtcatcagctacggaggctga

DBGET integrated database retrieval system