KEGG   Pseudomonas aeruginosa PAO1: PA1861
Entry
PA1861            CDS       T00035                                 

Symbol
modC
Name
(RefSeq) molybdenum ABC transporter ATP-binding protein ModC
  KO
K02017  molybdate transport system ATP-binding protein [EC:7.3.2.5]
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
pae02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:pae00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    PA1861 (modC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pae02000]
    PA1861 (modC)
Enzymes [BR:pae01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.5  ABC-type molybdate transporter
     PA1861 (modC)
Transporters [BR:pae02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Molybdate transporter
    PA1861 (modC)
SSDB
Motif
Pfam: ABC_tran TOBE AAA_21 AAA_23 AAA_22 AAA_29 AAA_16 AAA_30 RsgA_GTPase
Other DBs
NCBI-GeneID: 882019
NCBI-ProteinID: NP_250552
UniProt: Q9I2N4
Position
complement(2020625..2021710)
AA seq 361 aa
MDGLRLRFRRAYPGFELDIDLALPGRGVTALFGHSGSGKSTCLRCIAGLEKAAEGEVTIN
GETWQDSRRNLFVAPHRRALGYVFQDANLFRHLTVRRNLAFGLKRIAAAERRVELEQACA
LLGIEHLLERMPERLSGGEQQRVGIARALLTSPRLLLMDEPLASLDLKRKGEILPYLERL
HEELDIPVLYVSHSPDEVARLADHLVLLENGKVRASGPIGETLARVDLPLALDDDAGVVI
EGTVSDHDPAYGLLTLVLPGSALQMRVAHAPLAPGKRLRFKVQARDVSLNLRDDAQSSIL
NRLPVRVLELVDTDTAAHVLVRLDAGGNPLLARITRYSRDQLQLRPGQLLWAQIKSVAVL
A
NT seq 1086 nt   +upstreamnt  +downstreamnt
atggacggcctgcgcctgcgcttccgccgcgcctaccccggcttcgaactggacatcgac
ctggctcttcccggtcgtggcgtgaccgctctgttcggccattcaggctccggcaagagc
acttgcctgcgctgtatcgccggcctggaaaaggccgccgagggcgaggtgacgatcaac
ggcgagacctggcaggacagccgccgcaacctcttcgtcgcgccccaccggcgtgccctc
ggctacgtgttccaggatgccaacctgttccgccacctgacggtgcggcgcaacctggcc
ttcggtctcaagcgcatcgccgccgccgaacgccgcgtcgagctggaacaggcctgcgcc
ctgctgggcatcgagcatctgctggaacgcatgccggaacgcctctccggcggcgagcag
caacgcgtcggcatcgcccgggccctcctcaccagcccgcgcctgctgctgatggacgag
cctctggcatccctcgacctgaagcgcaagggcgagatcctgccctatctcgagcgcctg
cacgaggaactggacatcccggtgctctatgtcagccactcgccagacgaagtggcgcgc
ctggccgatcacctggtgctgctggagaacggcaaggtccgcgccagcgggccgatcggc
gaaaccctggcgcgagtcgacctgccgctggcgctggacgacgacgccggggtggtgatc
gagggcacggtcagcgaccacgacccggcctacggcctgctgaccctggtcctgcccggc
agtgcgctgcaaatgcgcgtcgcccacgccccgctggcccccggcaagcgcctgcgcttc
aaggtacaggcgcgcgacgtcagcctgaacctgcgcgacgacgcccagagcagcatcctc
aaccgcctgccggtacgggtcctggaattggtcgataccgacaccgcggcccacgtcctg
gtgcgcctggatgccggcggcaatccgctgctggcgcggatcacccgttactcgcgggac
cagttgcaactacgacccggccagctgttgtgggcgcagatcaagtcggtggcggtgctc
gcctga

DBGET integrated database retrieval system