KEGG   Pseudomonas aeruginosa PAO1: PA1862
Entry
PA1862            CDS       T00035                                 

Symbol
modB
Name
(RefSeq) molybdenum ABC transporter permease ModB
  KO
K02018  molybdate transport system permease protein
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
pae02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:pae00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    PA1862 (modB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pae02000]
    PA1862 (modB)
Transporters [BR:pae02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Molybdate transporter
    PA1862 (modB)
SSDB
Motif
Pfam: BPD_transp_1
Other DBs
NCBI-GeneID: 882065
NCBI-ProteinID: NP_250553
UniProt: Q9I2N3
Position
complement(2021712..2022398)
AA seq 228 aa
MALPLDSTDLAAIWLTIELASLTTLLLLLIGTPIAWWLARTRSWLKGPIGAVVALPLVLP
PTVIGFYLLVSMGPNGFIGQLTQSLGLGTLPFTFAGLVVGSVFYSLPFVVQPLQNAFEAI
GEKPLEAAATLRASPVDRFFSVVLPLARPGFVTAAILGFAHTVGEFGVVLMIGGNIPEKT
RVVSVQIFDHVEAMEYAQAHWLAGGMVAFSFVVLLALYSGRRRRPGWA
NT seq 687 nt   +upstreamnt  +downstreamnt
atggcgttgccactcgacagtacggacctggcggccatctggctgaccatcgagctggct
tcgctcaccaccctcctcctgctgctgatcggcacgcccatcgcctggtggctggcgcgc
acccgctcctggctgaaggggccgatcggcgcggtggtggccctgccgctggtgctgccg
ccgacggtgatcggcttctacctgctggtcagcatgggtcccaacggtttcatcggccag
ctcacccagagcctcggtctcggcaccctgcccttcaccttcgccggtctggtggtcggt
tcggtgttctactcgctgcccttcgtcgtgcaaccgttgcagaacgccttcgaggcgatc
ggcgagaaaccgctggaggctgccgcgaccctgcgcgcgagccccgtcgaccgtttcttc
agcgtggtcctgccgctggcccggccgggtttcgtcaccgccgcgatcctcggcttcgcc
cataccgtcggcgagttcggcgtggtgctgatgatcggcggcaacatcccggagaaaacc
cgcgtggtctcggtgcagatattcgatcacgtcgaagccatggaatacgcccaggcccac
tggctggccggcggcatggtggcgttctccttcgtcgtcctcctcgccctctattcgggc
cggcgccgccggccgggctgggcctga

DBGET integrated database retrieval system