KEGG   Pseudomonas aeruginosa PAO1: PA1863
Entry
PA1863            CDS       T00035                                 

Symbol
modA
Name
(RefSeq) molybdenum ABC transporter substrate-binding protein ModA
  KO
K02020  molybdate transport system substrate-binding protein
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
pae02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:pae00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    PA1863 (modA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pae02000]
    PA1863 (modA)
Transporters [BR:pae02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Molybdate transporter
    PA1863 (modA)
SSDB
Motif
Pfam: SBP_bac_11 SBP_bac_1
Other DBs
NCBI-GeneID: 877661
NCBI-ProteinID: NP_250554
UniProt: Q9I2N2
Position
complement(2022411..2023166)
AA seq 251 aa
MTTRLPQLLLALLASAVSLAASADEVQVAVAANFTAPIQAIAKEFEKDTGHRLVAAYGAT
GQFYTQIKNGAPFQVFLSADDSTPAKLEQEGEVVPGSRFTYAIGTLALWSPKAGYVDAEG
EVLKSGSFRHLSIANPKTAPYGLAATQAMDKLGLAATLGPKLVEGQNISQAYQFVSSGNA
ELGFVALSQIYKDGKVATGSAWIVPTELHDPIRQDAVILNKGKDNAAAKALVDYLKGAKA
AALIKSYGYEL
NT seq 756 nt   +upstreamnt  +downstreamnt
atgaccacccgcctgccccagctattgctcgccctcctcgccagcgccgtatccctggcc
gccagcgccgacgaggtgcaggtcgccgtcgcggccaacttcaccgcgccgatccaggcc
atcgccaaggaattcgagaaagacaccgggcacaggctggtcgccgcctacggcgccacc
ggccagttctatacgcagatcaagaacggcgcgccgttccaggtgttcctctccgccgac
gacagcactccggcgaaactggagcaggaaggcgaggtcgtgcccggctcgcgcttcacc
tatgccatcggcaccctggcactctggtcgcccaaggccggctatgtcgacgccgagggc
gaggtgctgaagagcggcagcttcaggcacctgtccatcgccaacccgaagaccgcgccc
tacggcctcgccgccacccaggcgatggacaagctcggcctcgccgccacgctcgggccg
aagctggtggaaggccagaacatcagccaggcctaccagttcgtttccagcggcaacgcc
gaactgggcttcgtcgctctgtcgcagatctacaaggatggtaaagtcgcaaccggctcg
gcctggatcgttcccaccgagctgcacgacccgatccgccaggacgcggtcatcctcaac
aagggcaaggacaacgccgccgccaaggccctggtcgactacctgaagggcgccaaggcc
gccgcgctgatcaagtcctacggctacgaactctaa

DBGET integrated database retrieval system