KEGG   Pseudomonas aeruginosa PAO1: PA1898
Entry
PA1898            CDS       T00035                                 

Symbol
qscR
Name
(RefSeq) quorum-sensing control repressor
Organism
pae  Pseudomonas aeruginosa PAO1
SSDB
Motif
Pfam: Autoind_bind GerE Sigma70_r4 Sigma70_r4_2
Other DBs
NCBI-GeneID: 880650
NCBI-ProteinID: NP_250589
UniProt: Q9RMS5 G3XD77
Structure
Position
2069490..2070203
AA seq 237 aa
MHDEREGYLEILSRITTEEEFFSLVLEICGNYGFEFFSFGARAPFPLTAPKYHFLSNYPG
EWKSRYISEDYTSIDPIVRHGLLEYTPLIWNGEDFQENRFFWEEALHHGIRHGWSIPVRG
KYGLISMLSLVRSSESIAATEILEKESFLLWITSMLQATFGDLLAPRIVPESNVRLTARE
TEMLKWTAVGKTYGEIGLILSIDQRTVKFHIVNAMRKLNSSNKAEATMKAYAIGLLN
NT seq 714 nt   +upstreamnt  +downstreamnt
atgcatgatgagagagagggatatctcgagattttgtcaagaataacaaccgaggaagag
ttcttctccctggttctcgagatatgcggtaattatggattcgaattcttttcattcggt
gcgcgggcgcctttcccgctgaccgcgcctaaatatcatttcctgtccaattacccaggg
gaatggaaaagcagatatatctccgaagactacacatccatcgacccgatcgtgcgccat
ggtctcctggaatacaccccgctgatctggaatggcgaagacttccaggagaaccgtttc
ttctgggaggaagcgctgcatcacggcatccgtcacggctggtcgatcccggtccgcggc
aagtacgggctgatcagcatgctgtccctggtgcgttccagcgagagcatcgccgccacg
gaaatcctggagaaggaatccttcctgctctggatcaccagcatgctgcaggctaccttc
ggcgacctgctggcgccgcgcatcgtcccggaaagcaatgtgcgcctgaccgccagggaa
accgagatgctcaagtggaccgcggtgggcaagacctacggcgagatcggcctgatcctg
tcgatcgaccagcgcacggtgaagttccatatcgtcaatgcgatgcgcaagctcaactcc
agcaacaaggcggaggccaccatgaaggcttacgccatcggcctgctcaactga

DBGET integrated database retrieval system