KEGG   Pseudomonas aeruginosa PAO1: PA1934
Entry
PA1934            CDS       T00035                                 

Definition
(RefSeq) hypothetical protein
Organism
pae  Pseudomonas aeruginosa PAO1
SSDB
Motif
Pfam: DUF4354 DUF4352
Other DBs
NCBI-GeneID: 879221
NCBI-ProteinID: NP_250624
UniProt: Q9I2H0
Structure
PDB: 
3NRF 3SB3

Position
2115885..2116265
AA seq 126 aa
MKNAMALTLAGLLAAPSLGFAAAPDAVMVFARQGDKGSVSVGDKHFRTQAFKVRLVNAAK
SEISLKNSCLVAQSAAGQSFRLDTVDEELTADTLKPGASVEGDAIFASEDDAVYGASLVR
LSDRCK
NT seq 381 nt   +upstreamnt  +downstreamnt
atgaagaacgcaatggccctgaccctggccggcctgctggccgctccttccctcggcttc
gccgccgcgccggacgcagtgatggtcttcgcccgccagggcgacaagggcagcgtgtcc
gtcggcgacaagcacttccgcacccaggccttcaaggtccgcctggtgaatgcggcgaag
agcgagatcagcctgaagaacagctgcctggtggcgcagtccgccgccggccagtccttc
aggctggataccgtggacgaggaactcaccgccgataccctcaagccgggcgcctccgtc
gaaggcgacgcgatcttcgcctccgaagacgacgcggtgtacggcgcatcgctggtcagg
ctgagcgaccggtgcaagtag

DBGET integrated database retrieval system