KEGG   Pseudomonas aeruginosa PAO1: PA2001Help
Entry
PA2001            CDS       T00035                                 

Gene name
atoB
Definition
(RefSeq) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
pae00071  Fatty acid degradation
pae00072  Synthesis and degradation of ketone bodies
pae00280  Valine, leucine and isoleucine degradation
pae00310  Lysine degradation
pae00362  Benzoate degradation
pae00380  Tryptophan metabolism
pae00620  Pyruvate metabolism
pae00630  Glyoxylate and dicarboxylate metabolism
pae00640  Propanoate metabolism
pae00650  Butanoate metabolism
pae00900  Terpenoid backbone biosynthesis
pae01100  Metabolic pathways
pae01110  Biosynthesis of secondary metabolites
pae01120  Microbial metabolism in diverse environments
pae01130  Biosynthesis of antibiotics
pae01200  Carbon metabolism
pae01212  Fatty acid metabolism
pae02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pae00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PA2001 (atoB)
   00630 Glyoxylate and dicarboxylate metabolism
    PA2001 (atoB)
   00640 Propanoate metabolism
    PA2001 (atoB)
   00650 Butanoate metabolism
    PA2001 (atoB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PA2001 (atoB)
   00072 Synthesis and degradation of ketone bodies
    PA2001 (atoB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PA2001 (atoB)
   00310 Lysine degradation
    PA2001 (atoB)
   00380 Tryptophan metabolism
    PA2001 (atoB)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PA2001 (atoB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PA2001 (atoB)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PA2001 (atoB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pae04147]
    PA2001 (atoB)
Enzymes [BR:pae01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PA2001 (atoB)
Exosome [BR:pae04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PA2001 (atoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt DSBA
Motif
Other DBs
NCBI-GeneID: 879046
NCBI-ProteinID: NP_250691
PathoGenesis: PA2001
UniProt: Q9I2A8
Position
2187065..2188246
Genome map
AA seq 393 aa AA seqDB search
MQDVVIVAATRTAVGSFQGSLAGIPAPELGAAVIRRLLEQTGLDAGQVDEVILGQVLTAG
SGQNPARQAAIKAGLPVGVPAMTLNKVCGSGLKALHLGAQAIRCGDAEVIVAGGQENMSL
APYVMPGARTGLRMGHAKLVDSMIEDGLWDAFNDYHMGITAENLAEKYGLTREEQDAFAA
ASQQKAIAAIEGGRFRDEITPIQVPQRKGEPLGFDTDEQPRAGTTVEALAKLKPAFRKDG
SVTAGNASSLNDGAAAVLLMSAAKAKALGLPVLARIASYASAGVDPAIMGIGPVSATRRA
LDKAGWSLEQLDLIEANEAFAAQSLAVGRELGWDAARVNVNGGAIALGHPIGASGCRVLV
TLLHEMIRRDAKKGLATLCIGGGQGVALTLARD
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgcaagacgtcgtcatcgtcgccgctacccgtaccgccgtcggcagcttccagggctcg
ctggccggcattcccgcccccgagctgggcgccgcggtaatccgccgcctgctcgaacag
accggtctcgatgccggccaggtcgacgaagtgatcctcggccaggtgctcaccgccggg
tccgggcagaacccggcgcgccaggcggcgatcaaggccggcctgccggtcggcgtgccg
gccatgaccctgaacaaggtctgcggctccggcctcaaggccctgcacctgggcgcccag
gcgatccgctgcggcgacgccgaggtgatcgtcgccggcggccaggagaacatgagcctg
gcgccctacgtcatgcccggcgcccgcaccggcctgcgcatgggccatgcgaagctggtc
gacagcatgatcgaggacggcctgtgggacgccttcaacgactaccacatgggcatcacc
gccgagaacctggcggagaagtacggcctgacccgcgaggagcaggacgccttcgccgcc
gcttcgcagcagaaggccatcgccgccatcgagggcgggcgcttccgcgacgagatcacg
ccgatccaggtcccgcagcgcaagggcgagccgctgggcttcgataccgacgagcagccg
cgcgccggcaccaccgtcgaggccctggccaagctcaagccggccttcaggaaggacggc
agcgtcaccgccggcaacgcctccagcctcaacgacggcgccgccgcggtattgctgatg
agcgcggccaaggccaaggccctgggcctgccggtgctggcgcggatcgccagctacgcc
agcgccggggtcgacccggcgatcatgggcatcggcccggtctccgccacccgtcgcgcg
ctcgacaaggccggctggagcctggagcaactggacctgatcgaggccaacgaggccttc
gccgcgcagtccctggcggtgggccgggaactgggctgggatgccgccagggtcaacgtc
aacggcggcgccatcgcccttggccacccgatcggcgcgtccggctgccgggtgctggtg
accctgctgcacgagatgatccgtcgcgacgcgaagaagggcctcgccaccctgtgcatc
ggcggcgggcagggcgtcgccctgaccctggcccgcgactga

DBGET integrated database retrieval system