KEGG   Pseudomonas aeruginosa PAO1: PA2056
Entry
PA2056            CDS       T00035                                 
Name
(RefSeq) transcriptional regulator
  KO
K18900  LysR family transcriptional regulator, regulator for bpeEF and oprC
Organism
pae  Pseudomonas aeruginosa PAO1
Brite
KEGG Orthology (KO) [BR:pae00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pae03000]
    PA2056
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:pae01504]
    PA2056
Transcription factors [BR:pae03000]
 Prokaryotic type
  Helix-turn-helix
   LysR family
    PA2056
Antimicrobial resistance genes [BR:pae01504]
 Gene sets
  Multipdrug resistance modules
   Multidrug resistance, efflux pump BpeEF-OprC [MD:M00698]
    PA2056
SSDB
Motif
Pfam: LysR_substrate HTH_1
Other DBs
NCBI-GeneID: 877802
NCBI-ProteinID: NP_250746
UniProt: Q9I259
Position
2249693..2250595
AA seq 300 aa
MDLNAVKLLARVAETRSFTQAAVSLGLTQSGLSRAIGRLEAELGVRLLHRTTRSVSLTPD
GQLFYERCAPLLAELEEVEKLLVDRQCAPSGPLKITTPQALGRIVIMPVLRELTRCYPQL
QIEAAMTDRLVDLTEEGFDAAVRLGRVGDVRLIARPLAALRWVTVASPEYLRGHGTPERL
EQLAGHNCPTVRDLHTGKLLEWQFQRDGQPLSLAVRGDLVLDVADALVDAALVGQGIVQV
MGFMAEEAIRRRRLVRILQPFEPPLCPVSLIYPPSRQCSLKIGALYEELKSAHWCGALTY
NT seq 903 nt   +upstreamnt  +downstreamnt
atggacctgaatgccgtcaagttgctcgcccgcgtggccgagacccgtagcttcacccag
gccgccgtttctctcggtctgacccagtccggcctgtcgcgcgccatcggccggctggaa
gccgaactcggcgtgcgtctgctgcaccgcaccacccgcagcgtcagcctgaccccggac
ggccagctgttctacgagcgctgcgcacccttgctggcggaactggaggaagtcgagaag
ttgctggtggaccgccagtgcgcgccgagcggtccgctgaagatcaccaccccgcaggcg
ctcgggcggatcgtgatcatgccggtgctgcgcgaactgacgcggtgctacccgcaattg
cagatcgaggcggcgatgaccgatcgcctggtcgacctcaccgaggaaggcttcgacgcc
gccgtgcgtctcggtcgggtcggcgacgtgcgcctgatcgcccggccattggcggcgttg
cgctgggtcacggtggcgtcgccggaatacctgcgtggccacggcacgccggagcgcctg
gagcaactcgccgggcacaactgcccgacggtgcgcgacctgcataccggcaagctgctg
gaatggcagttccagcgcgacggccagccgctgagcctggcggtgcgcggcgacctggtg
ctggacgtggccgacgcgctggtcgacgcggcgctggtcggccagggcatcgtccaggtg
atgggcttcatggccgaggaggcgatccgccggcgtcgactggtacgcatcctccagccg
ttcgaaccgccgctgtgcccggtgtcgctgatctacccgccgtcgcggcagtgctcgctg
aagatcggcgcgctctacgaggaactgaagagcgcgcactggtgcggggcgctgacgtac
tga

DBGET integrated database retrieval system