KEGG   Pseudomonas aeruginosa PAO1: PA2066
Entry
PA2066            CDS       T00035                                 
Name
(RefSeq) hypothetical protein
Organism
pae  Pseudomonas aeruginosa PAO1
SSDB
Motif
Pfam: DUF218
Other DBs
NCBI-GeneID: 877703
NCBI-ProteinID: NP_250756
UniProt: Q9I249
Position
complement(2265126..2265764)
AA seq 212 aa
MSPTLQDARLLWDFLGQGRCHVPCELLVVCGSYDLRVCDHACELLERGLAERLLFTGNTG
HWTRHLWVEPEAELFARHARARGVSDSLIVIEPRATNFAENIAFARELFPDLRRATFVTK
PNSIRRVALTLPVRWPGLEGHVDAPDYAFPDGISNLVGVLGVIDEMVGDLDRIMRYPALG
FQVACPIPAQVMDAWERLVARGFDRHLVNPPR
NT seq 639 nt   +upstreamnt  +downstreamnt
atgagcccgaccctgcaagatgcccggctgctctgggacttcctcggccagggccgctgc
catgtgccctgcgaactgctggtggtgtgcggctcctacgacctgcgggtctgcgaccac
gcctgcgaactgctcgaacgcggcctcgccgaacgcctgctgttcaccggcaacaccggg
cactggacgcgccatctctgggtcgagccggaagccgagctgttcgcccgccacgccagg
gcacgcggggtaagcgacagcctcatcgtgatcgagccgcgggcgaccaacttcgccgag
aacatcgccttcgcccgcgagctgttccccgacctgcgccgcgcgaccttcgtcaccaag
cccaactcgatccgccgcgtggcgctgaccctgccggtccgctggccgggtctggaggga
cacgtggatgcgcccgactacgcatttcccgacggcatctcgaacctggtcggcgtactc
ggggtgatcgacgagatggtcggcgaccttgaccgcatcatgcgttacccggcgctgggc
ttccaggtcgcctgcccgatcccggcgcaggtcatggacgcctgggaacgcctggtggcg
cgcggtttcgaccgccacctggtgaacccgccgcgctga

DBGET integrated database retrieval system