KEGG   Pseudomonas aeruginosa PAO1: PA2084Help
Entry
PA2084            CDS       T00035                                 

Definition
(RefSeq) asparagine synthetase
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
pae00250  Alanine, aspartate and glutamate metabolism
pae01100  Metabolic pathways
pae01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pae00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PA2084
Enzymes [BR:pae01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     PA2084
Peptidases [BR:pae01002]
 Cysteine Peptidases
  Family C44
   PA2084
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 NAD_synthase
Motif
Other DBs
NCBI-GeneID: 877958
NCBI-ProteinID: NP_250774
PathoGenesis: PA2084
UniProt: Q9I231
Position
2293153..2294985
Genome map
AA seq 610 aa AA seqDB search
MCGITGWTDWSRDLGEQRSILERMTRTLAPRGPDAEGLWLSRHALLGHRRLAIIDLENGA
QPMLAEAGGRVALTYSGEVYNFRELRAELETLGQVFRTRSDTEVVLRAYLQWGEASFVRL
RGIYGFALWDEREQSLWLVRDRFGVKPLYYYPTAGGVLFASEPKAIFANPEANPVLDASG
IAELFALTTAPTPGHGLYKGLRQVRPGQALRFDRNGVRELVYWALRAERHEEGAEDSAER
AGQLLREAVAEQLVADVPLGSLLSGGLDSSAISAFAVAALDGDARRLPTFSVDFPGEGRG
FVPTPWQSSWDEPYAQLAANFLGTPHRTVLVAPEEVLEQDEAVLQARDLPGWGELDASLY
LLFRQVREHTTVALSGESADEVFGGYPFFHDPSALAHDGFPWLAGKSGPWQLLRREVAER
VAAPEYIRARYREALAEVPRLDGEDAAQRRQREVAYLALSRWLPAMLERKDRMSMAVGLE
VRVPFCDHRLVEYVWNLPWALKSVAGESKSLLRRALRGHLPQAILERRKSGFPANPDPRY
LALLRERVGRLLDDGRSPLFELVDAGRVRQALEQGTPLPSPRASASPTAGLAYLLNLDRW
LTRHGVDISL
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaatcaccggctggaccgactggagccgcgacctcggcgagcagcgcagcatc
ctcgaacgcatgacccgtaccctggccccgcgcgggccggacgccgaaggcctgtggctg
tcgcggcacgcgctgctcggccatcggcgcctggcgatcatcgacctggagaacggcgcc
cagccgatgcttgccgaggctggcgggcgggtggcgctgacctacagcggcgaggtctac
aacttccgcgagctgcgcgccgagctggagacgctgggccaggtcttccgcacccgctcg
gacaccgaagtggtgctgcgcgcctatctgcaatggggcgaggcttccttcgtccggctc
cgcggcatctacggcttcgccctgtgggacgagcgcgagcagagcctgtggctggtgcgc
gatcgcttcggggtcaagccgctgtactactacccgaccgccggaggcgtgctgttcgcc
tcggaacccaaggcgatcttcgccaaccccgaggccaacccggtgctcgacgccagcggc
atcgccgagctgttcgccctgaccaccgcgccgactcccggccacggcctgtacaagggc
ctgcgccaggtccggccgggccaggcgctgcgcttcgaccgcaatggtgtgcgcgagttg
gtctactgggcgctgcgcgcggaacgtcacgaagagggcgccgaggacagcgccgaacgc
gccggccagttgctccgcgaggcggtggccgagcaactggtggccgacgtcccgctgggc
agcctgctttccggcgggctagactccagcgccatcagtgccttcgcggtggccgcgctg
gatggcgacgcgcggcgcctgccgaccttctccgtggacttccccggcgaaggccgcggc
ttcgtcccgacgccctggcaaagcagctgggacgaaccctatgcgcagctggcggcgaac
ttcctcggtacgccgcaccgtaccgtgctggtcgccccggaagaggtgctggaacaggac
gaggcggtgctccaggcccgcgacctgcccggctggggcgagctggacgcctcgctctac
ctgctgttccgccaggtccgcgagcacaccacggtggcactgtcgggcgagtcggccgac
gaggtgttcggcggctacccgttcttccacgacccgagcgccctcgcacacgacggcttc
ccctggctggccggcaagagcgggccctggcaactgctgcggcgggaggtcgccgaacgg
gtggcggcgccggaatacatccgggcgcgctaccgcgaggccctcgccgaagtgccgcgg
ctggatggcgaggatgccgcccagcgacgccagcgcgaggtcgcctacctggcgctgagc
cgctggctgccggcgatgctcgaacgcaaggaccggatgagcatggcggtcggcctggaa
gtgcgcgtgccgttctgcgaccaccgcctggtggagtacgtatggaacctgccctgggcg
ctgaagagcgtcgccggggaaagcaagagcctgctgcgccgggccctgcgcgggcacctg
ccgcaggcgatcctggagcggcgcaagagcggtttcccggccaaccccgacccacgttac
ctggcgctgctgcgcgagcgggtcggccgcctgctcgacgacggccgctcgccgctgttc
gaactggtggacgccgggcgggtccgccaggctctcgaacagggcacgccgctgcccagc
ccgcgtgcctcggcgagcccgaccgccggcctggcctacctgctgaacctggaccgctgg
ctgacccgccatggggtcgacatcagcctctga

DBGET integrated database retrieval system