KEGG   Pseudomonas aeruginosa PAO1: PA2138Help
Entry
PA2138            CDS       T00035                                 

Definition
(RefSeq) multifunctional non-homologous end joining protein LigD
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
pae03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:pae00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    PA2138
Enzymes [BR:pae01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     PA2138
DNA repair and recombination proteins [BR:pae03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     PA2138
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_C DNA_ligase_A_M DNA_primase_S
Motif
Other DBs
NCBI-GeneID: 880451
NCBI-ProteinID: NP_250828
PathoGenesis: PA2138
UniProt: Q9I1X7
Structure
PDB: 

Position
2353086..2355608
Genome map
AA seq 840 aa AA seqDB search
MPSSKPLAEYARKRDFRQTPEPSGRKPRKDSTGLLRYCVQKHDASRLHYDFRLELDGTLK
SWAVPKGPCLDPAVKRLAVQVEDHPLDYADFEGSIPQGHYGAGDVIVWDRGAWTPLDDPR
EGLEKGHLSFALDGEKLSGRWHLIRTNLRGKQSQWFLVKAKDGEARSLDRFDVLKERPDS
VLSERTLLPRHGEAATPAARPARRGKSGGKTPMPEWIAPELASLVEQPPRGEWAYELKLD
GYRLMSRIEDGHVRLLTRNGHDWTERLPHLEKALAGLGLQRSWLDGELVVLDEEGRPDFQ
ALQNAFEEGRGENILYVLFDLPYHEGEDLRDVALEERRARLEALLEGRDEDPLRFSATLA
EDPRDLLASACKLGLEGVIGKRLGSAYRSRRSNDWIKLKCQLRQEFVIVGYTEPKGSRRH
IGALLLGLYSPDEERRLRYAGKVGSGFTAASLKKVRERLEPLAVRSSPLAKVPPARETGS
VQWVRPQQLCEVSYAQMTRGGIIRQAVFHGLREDKPAREVTGERPAGPPPLRGARKASAG
ASRAATAGVRISHPQRLIDPSIQASKLELAEFHARYADLLLRDLRERPVSLVRGPDGIGG
ELFFQKHAARLKIPGIVQLDPALDPGHPPLLQIRSAEALVGAVQMGSIEFHTWNASLANL
ERPDRFVLDLDPDPALPWKRMLEATQLSLTLLDELGLRAFLKTSGGKGMHLLVPLERRHG
WDEVKDFAQAISQHLARLMPERFSAVSGPRNRVGKIFVDYLRNSRGASTVAAYSVRAREG
LPVSVPVFREELDSLQGANQWNLRSLPQRLDELAGDDPWADYAGTRQRISAAMRRQLGRG
NT seq 2523 nt NT seq  +upstreamnt  +downstreamnt
atgcccagcagcaagccgctcgccgagtacgcccgcaagcgcgatttccgccagaccccg
gagcccagcggccgcaagcctcgcaaggacagcaccgggctgctccgctattgcgtccag
aagcacgacgccagccgcctgcactacgacttccgcctggagctggatggcaccctgaag
agctgggcggtgcccaaggggccgtgcctcgacccggcggtgaagcggctcgcggtgcag
gttgaggaccatccgctggactatgccgatttcgaaggcagcatcccccaggggcactac
ggcgccggcgatgtcatcgtctgggaccgaggcgcctggacgcctctggacgatccgcgc
gagggcctggaaaagggccatctcagcttcgccctggatggcgagaaactctccgggcgt
tggcacctgatccgcaccaacctgcgcggcaagcagtcccagtggttcctggtcaaggcc
aaggacggcgaggcgcgcagcctggatcgcttcgacgtgctgaaggagcgtcccgacagc
gtgctcagcgagcgtacgctgctgccccgccatggcgaagccgccacgcccgcggccagg
ccggcgcgacgcggcaagagcggggggaagacgccgatgcccgagtggatcgcccccgag
ctggccagcctggtcgagcagcctccgcgaggggagtgggcctacgaactcaagctggac
ggctatcggctgatgagccgcatcgaagacggccacgtgcgcctgctgacccgcaacggc
catgactggaccgaacgcctgccacacctggagaaggccttggccgggctcggtctgcag
cgcagttggctggacggcgaactggtcgtcctcgacgaggagggtcgaccggacttccag
gccctgcagaacgccttcgaggaaggtcgcggcgagaacatcctgtacgtcctcttcgac
ctgccgtaccacgaaggcgaggatctgcgcgatgtcgccctggaggagcgccgcgcgcgc
ctggaggcgctgctggaagggcgagacgaagacccgctgcggttctccgcgacgctcgcg
gaagacccccgcgacctgctggccagcgcctgcaagctcggtctcgaaggcgtgatcggc
aagcgtctgggcagcgcctaccgttcgcgccgcagcaacgactggatcaagctgaagtgc
cagttgcgccaggagttcgtgatcgtcggctataccgagccgaagggctctcgccggcat
atcggcgccttgctgctcggcctctacagccctgacgaggagcgccggctgcgctatgcc
ggcaaggtcggcagcggcttcaccgcggccagcctgaagaaggtccgtgagcgcctggaa
cccctcgcggtccgctccagcccattggcgaaggtgccgccggcgcgcgagaccgggtcg
gtgcagtgggtgcgcccgcaacagctgtgcgaggtttcctatgcgcagatgacccgtggc
gggatcatccgccaggcagtgttccacggcttgcgcgaagacaagccggcgcgcgaggtg
accggcgagcgtcccgccggcccgccgccgctgcgcggcgcgcgcaaggccagcgccggt
gcgtcgcgggcggccaccgccggcgtgcgcatcagccatccgcagcggctgatcgacccg
tcgatccaggccagcaagctggaactcgccgagttccatgcgcgctacgccgacctgctc
ctgcgcgacctgcgcgagcgcccggtgtcgctggtgcgcggccccgacggaatcggcggc
gaactgttcttccagaagcacgcggcgcgcctgaagatccccggcatcgtccagctcgac
ccggcgctcgatcccggtcatccgccgctgttgcaaatccgcagcgccgaggcgctggtc
ggcgcggtgcagatgggcagcatcgaattccatacctggaacgccagcctggccaacctg
gagcggcccgaccgtttcgtcctcgacctcgacccggacccggcgctgccgtggaagcgc
atgctcgaagcgacccagctgagcctgacgttgctcgacgagctgggcctgcgcgccttc
ctcaagaccagcggcggcaagggcatgcacctgctggtgccgctggagcgccggcatggc
tgggacgaggtcaaggatttcgcccaggccatctcccagcacttggcgcgcctgatgccg
gagcgtttctcggcggtttccgggccgcgcaaccgggtcggcaagatcttcgtcgactac
ctgcgcaacagccgcggcgccagcaccgtggccgcctactcggtgcgcgcccgcgaaggg
ttgccggtgtcggtaccggtgttccgcgaggaactcgactcgctgcagggcgccaaccaa
tggaacctgcgcagtctgccgcagcgcctcgacgaactcgccggcgacgatccctgggcc
gactacgccggcacccgccagcgcatcagcgcggccatgcggcgccagctcgggcgcggc
tga

DBGET integrated database retrieval system