KEGG   Pseudomonas aeruginosa PAO1: PA2259Help
Entry
PA2259            CDS       T00035                                 

Gene name
ptxS
Definition
(RefSeq) transcriptional regulator PtxS
  KO
K02525  LacI family transcriptional regulator, kdg operon repressor
Organism
pae  Pseudomonas aeruginosa PAO1
Brite
KEGG Orthology (KO) [BR:pae00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pae03000]
    PA2259 (ptxS)
Transcription factors [BR:pae03000]
 Prokaryotic Type
  Helix-turn-helix
   LacI family
    PA2259 (ptxS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peripla_BP_3 Peripla_BP_1 LacI HTH_31 TetR_N HTH_3 HTH_IclR Peripla_BP_4 MarR_2 HTH_24 HTH_6
Motif
Other DBs
NCBI-GeneID: 877811
NCBI-ProteinID: NP_250949
PathoGenesis: PA2259
UniProt: O84915 G3XD97
Position
2487856..2488878
Genome map
AA seq 340 aa AA seqDB search
MNGSVLPSRGRVTINQVAEAAGVSKASVSRYIGGDRQLLADATARRIERAIDQLDYRPNQ
MARGLKRGRTRLIGMLVADILNPYSVAVMHGVETACREHGYSLVVCNTDRDDEQERHHLA
ALQSYNVEGLIVNTLGHHPGELRALHRELPMVLVDRQLAELDTDLVGLDNADAVEQALDH
LQHRGFRDILLVTEPLDGTSSRIERVQAFNASIGRRPALKGQVLQTDDFFRDGLRAFLSA
SGPGPKALFTCNGVATLCATRQLRDLGCRLFDEVGLLALDELDWYPLVGSGITALAQPTD
EIGRTAFERLLARLEGDREPARRVTFPAQLIVRGSTHPRG
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
gtgaatggttcagtactgcccagccgtggccgcgtcaccatcaaccaggtggccgaggcc
gccggcgtctccaaggccagcgtgtcgcgctatatcggcggcgaccgccagttgctcgcc
gatgccaccgcccggcgcatcgagcgcgccatcgaccagctcgactaccgccccaaccag
atggcccgaggcctcaagcgcgggcgcacacggctgatcggaatgctggtggcggacatc
ctcaacccctactccgtggccgtcatgcatggcgtggaaaccgcctgccgcgaacacggc
tacagcctggtggtgtgcaataccgaccgcgacgacgagcaggagcgtcatcacctggcc
gccctgcagtcctacaacgtcgaaggactgatcgtgaacaccctcggccaccatcccggc
gaattgcgcgccctgcaccgcgaactgccgatggtgctggtggaccgccagttggccgag
ctggataccgacctggtcggcctggacaacgccgacgccgtcgaacaggccctcgaccac
ctgcagcaccgcggcttccgcgacatcctgctggtcaccgaaccgctcgacggcaccagc
tcgcggatcgagcgggtccaggccttcaatgcctccatcggccggcgaccggcgctcaag
ggccaggtcctgcaaaccgacgacttcttccgcgacggcctgcgcgccttcctttcggcc
agcggccccgggccgaaggcgctgttcacctgcaacggcgtcgccaccctctgcgccacc
cgccaactgcgcgacctcggctgccggctgttcgatgaggtcggcctgctggccctggac
gaactcgactggtacccactggtgggcagcggcatcaccgccctcgcccaacccaccgac
gaaatcggccgcaccgccttcgagcgcctcctggcgcgactcgaaggcgaccgcgagccg
gcgcgccgggtgaccttcccggcgcaactgatcgttcgcggctcgacccatccacgcggc
tag

DBGET integrated database retrieval system