KEGG   Pseudomonas aeruginosa PAO1: PA2263Help
Entry
PA2263            CDS       T00035                                 

Definition
(RefSeq) 2-hydroxyacid dehydrogenase
  KO
K00032  phosphogluconate 2-dehydrogenase [EC:1.1.1.43]
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
pae00030  Pentose phosphate pathway
pae00480  Glutathione metabolism
pae01100  Metabolic pathways
pae01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pae00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PA2263
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    PA2263
Enzymes [BR:pae01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.43  phosphogluconate 2-dehydrogenase
     PA2263
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 Rossmann-like F420_oxidored
Motif
Other DBs
NCBI-GeneID: 877698
NCBI-ProteinID: NP_250953
UniProt: G3XCL1 Q9I1L0
Position
2492064..2493050
Genome map
AA seq 328 aa AA seqDB search
MKKVVLYKRLSAPLMERLRERVEVLLVEEPGRDGLARLRDALPEAHGLLGASLRLDAGLL
DLAPRLEAIASVSVGVDNYDIDYLDRRGILLSNTPDVLTETTADTGFALILATARRVVEL
AGWVRAGEWKKSVGAAQFGTDVHGKTLGIVGMGRIGEALARRGHHGFGMRVLYHSHSPKP
HVEERYAASYRPLDALLEESDFVCLTLPLTAATEGLIGAAQFARMRPQAIFINISRGRVV
DEAALIEALAQRRIRAAGLDVFEREPLSPDSPLLRLPNVVATPHIGSATEETREAMARCA
VDNLLAALAGARPLNLVNPSAWARRRGA
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaagtggttctctacaaacgtctctccgcgcccctgatggaacgcctgcgcgaa
cgggtcgaggtgctcctggtcgaggagcccggccgcgacggcctggcccgcctgcgcgac
gccctgcccgaggcccacggcctgctcggcgccagcctgcgcctggacgccggactgctc
gacctggcaccgcgactggaagccatcgccagcgtctcggtgggcgtcgacaactatgac
atcgactacctcgaccgccgcggcatcctcctcagcaatacccccgacgtgctcaccgag
accaccgccgacaccggcttcgcgctgatcctggcgacagcccggcgggtagtggaactg
gccggctgggtgcgcgccggggaatggaagaagagcgtcggcgccgcccagttcggtacc
gacgtgcatggcaagaccctcggtatcgtcggcatgggccgcatcggcgaggccctggcc
cggcgcgggcaccacggcttcggcatgcgcgtgctgtaccacagccatagcccgaagccc
cacgtcgaagaacgctacgcagcgagctaccgccccctcgacgcgctgctcgaggaatcc
gacttcgtctgcctgaccctgccgctgaccgccgccaccgaaggcctgatcggtgccgcg
cagttcgcccggatgcgcccgcaggcgatcttcatcaacatctcccgtggccgggtggtc
gacgaggcggccctgatcgaggccctggcccagcggcggatccgcgccgccggcctcgac
gtgttcgagcgcgagccgctgtctcccgactcgccgctgctgcgcctgccgaacgtggtg
gccactccccacatcggctcggccaccgaggaaacccgcgaagccatggcccgctgcgcg
gtagacaacctgctggccgccctcgccggcgcgcggccgctgaacctggtcaatccttcg
gcctgggcgcgacggcgaggcgcctga

DBGET integrated database retrieval system