KEGG   Pseudomonas aeruginosa PAO1: PA2361
Entry
PA2361            CDS       T00035                                 

Definition
(RefSeq) hypothetical protein
  KO
K11891  type VI secretion system protein ImpL
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
pae02025  Biofilm formation - Pseudomonas aeruginosa
pae03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pae00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PA2361
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    PA2361
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pae02044]
    PA2361
Secretion system [BR:pae02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PA2361
SSDB
Motif
Pfam: IcmF-related_N HMG_box
Other DBs
NCBI-GeneID: 882236
NCBI-ProteinID: NP_251051
UniProt: Q9I1B8
Position
complement(2608229..2612044)
AA seq 1271 aa
MSGATLFMLVLLLVLLALLLGALGWWWRTRGGTEIRSFYAAVRQMEREQGWQGRYEAPWL
LMLGNETEGEQLCSTWRLLPVARPAWFGRWWSDGEGAILLVPESVFLPDEGLRRQSGAWL
RLLRLFLRLRGRRALDGVVWNIPLARLQDGEQAANLGLAARRRYVELTQRLGLSLPVYVV
ITGMEDLPGFQELLAALPEEARERALGWSSPFAAEAAWQSRWCEQALEEITATLTESIVE
LGTLRGQVDNELYCLPPRLESLRGSLQALLEPVFQGNARGEAPRFRGLYLSGSEAAGAAA
DEVLPAVDAPRRRSSFASQLWARRILAEEGLAQAVPRILQLRQRWQRGIGLAALCLCLLW
GGLMTWVWRDALRDAGELSQLLHGASERYQPLDDDTRRAAQVRQNVQAWWQLVSQAPRWR
FTSLAFPSSWFSSLDARIDNAYRRVSERLLVRPLRSLLEGEASDLRAIRSDGQPGLKEGD
DPSQWKDYLAAKDLVARATTLERHNRLFAQAIDNRRTPLDDLLQLSNDALGSSYNAGSLA
RLAYYNRTLFAERPADLAALDLGRVAATAADNFHDLMARWLNAYFLTDSLERTGNALTQE
LAQLGQERDATAAQLLGIGELINHLQQQVNRINLIWGNGVGQDLVPGYQNLLKSAQQSSL
LGNRVEELQNLTVQLQQQFRSEWIAPPEAAGDGLLVKQGATLKLADDLLGLKRAIDDLKT
KDFVSVALADKTLADHSLLSIDDIGVTQALSFFNDFTGYYESTLPSLNPRYRYSVLHAAA
SAATEAMWQSLGPRSRSLASRNASRFDVQVKQVQVLQAALLELQDLQAGARLLLSLNALA
VADIGQALRDIDEQAVLREPVDFSRWSGAPNFGLQMFRAQDSAELKQSLNSQFNAMAAVA
ERHAPALEWLQAQQSSLATADYNAFVRFSALNAELQKFKADNPASTAAQLAKLVGNDFNQ
MDIGSCADILNGVLLPSSRSDLATRLVDLRQGALGRCQSLQQQQAAQAWKDLADYFNQYL
AGRFPFAYSLEAADAEPGRVRHLLQLMETRLPQVREGLAQVRSPDLPAAEDFVRRLEQAQ
RWLGPLFERDKSGLLGVALDIDWRSDRSLERGADQVIAWSLYSGDQESRFPGAQDKGLTW
NVGDPLKIMLRWAKNGSQRPADDPRQASLAVADLEAGWSYQGSWALLRMMRAHFSRQRPP
NVDYTEFPLVLQLPVYAPYSPENEARMFLRLSLMSLGGKTPLSIQPLPVRAPQSPFATLL
PATVASTGGTP
NT seq 3816 nt   +upstreamnt  +downstreamnt
atgagcggcgcgacgctgttcatgctggttctcctcctggtgctgctggcgctgctgctg
ggggcgctgggctggtggtggcgaacccgcggtggtacggagatccgcagcttctacgcg
gcggtccggcagatggagcgcgagcagggctggcagggccgctacgaagcgccgtggctg
ctgatgctcggcaacgagaccgagggcgagcagttgtgctccacctggcgtctgctgccg
gtggcgcgcccggcctggttcggccgctggtggtcggacggcgagggggcgatcctgctg
gtgcccgagtcggtgttcctgcccgacgagggcctgcgccggcaaagcggcgcctggctg
cgcctgttgcgtctgttcctgcgcctgcgcggcaggcgcgcgctggacggagtggtctgg
aacattccgctggcgcggctgcaggatggcgagcaggcggccaacctcggcctcgccgcg
cgccgtcgctacgtggaactgacccagcgccttggcctgagcctgccggtttacgtggtg
atcactggcatggaagacctgcctggcttccaggaacttctcgcggcgctgcccgaggag
gcgcgcgagcgcgccctcggctggtcctcgccgttcgccgccgaagcggcctggcagtcg
cgctggtgcgagcaggcgctggaggaaatcaccgccaccctgaccgagtcgatcgtcgaa
ctcggtaccttgcgcggccaggtggacaatgagctgtattgcctgccgccacgcctggaa
agtctccgcggttcgttgcaggcgctgctcgaaccggtcttccagggcaacgccaggggc
gaggcgccgcgctttcgcggtctctacctgagcggcagcgaggcggcgggcgcggcagcc
gacgaagtcctgccggcggtcgacgcgccgcgtcggcgcagcagcttcgccagccaactg
tgggcacggcggatccttgccgaggaaggcctggcccaggcggtgccgcgcatcctccag
ctgcgtcagcgctggcagcgcgggatcggcctcgccgcgttgtgcctgtgcctgctctgg
ggcggcctgatgacctgggtctggcgcgacgcgctgcgcgacgccggtgaactgtcgcaa
ctgctgcatggcgccagtgagcgctaccagccgctcgacgacgacactcggcgcgccgcc
caggtccggcagaacgtccaggcctggtggcaactggtgtcacaggcgccgcgctggcgc
ttcacttcgctggcgtttcccagttcctggttttcctccctggatgcacgtatcgacaac
gcgtatcgccgcgtttccgagcgcctgctggtgcgaccgctgcgcagcctgctggaaggc
gaggcgagcgacctgcgggcgatccgcagcgatggccaacccggcctgaaggagggcgac
gaccccagccagtggaaggactacctggcggcgaaggacctggtcgcccgcgccactacg
ctggagcgccacaatcgcttgttcgcccaggccatcgacaaccgcaggacgccgctcgac
gaccttctgcaactgagtaacgatgccttgggcagcagctacaacgccggcagcctggcg
cgcctggcctattacaaccgcacgctgttcgccgagcgtccggccgatctcgccgccctc
gacctgggccgggtcgccgccacggcggcggataacttccatgacctgatggcacgctgg
ctgaacgcctacttcctcaccgacagcctggaacgcaccggcaatgccctgacccaggaa
ctcgcgcagctcggccaggaacgagacgccacggcggcccagttgctggggatcggcgaa
ttgatcaaccacctgcagcaacaggtcaaccgcatcaacctgatctggggcaatggcgtc
ggccaggatctcgtccctggctaccagaacctgctcaagagcgcccagcaaagcagcttg
ctgggaaaccgcgtggaggaactgcagaacctcaccgtgcagttgcagcagcagtttcgc
agcgaatggatcgcgcctccggaggctgccggcgacggcctgctggtgaaacagggggcg
acgctcaagctggccgatgacctgctcggtctgaaacgcgccatcgatgacctgaagacc
aaggacttcgtctccgtggccctggcggacaagacactggcggaccactccttgctgagc
atcgacgatatcggcgtgactcaggcgttgagcttcttcaacgacttcaccggctactac
gagagcaccctgccatcgctcaacccgcgctatcgctattcggtcctgcacgccgccgcc
agcgcggcgaccgaggccatgtggcaaagcctcgggccgcgcagtcgtagcctggccagt
cgcaatgcctcgcgtttcgacgtgcaggtcaagcaggtccaggtgttgcaggcggcgctg
ctggagttgcaggacctgcaggccggcgcgcgcctgctgctcagcctcaacgcgctggcc
gtggccgatatcggccaggccctgcgcgacatcgacgagcaggcggtgctgcgcgagccg
gtcgatttcagccgctggtcgggcgcgccgaatttcggcctgcagatgttccgcgcccag
gacagtgccgagctgaagcaaagcctgaacagccagttcaatgccatggcggccgtcgcc
gaacgccacgccccggcgctggagtggttgcaggcgcagcaatccagcctggccaccgcc
gactacaacgcgttcgtgcgcttcagcgcgctcaacgccgaactgcagaaattcaaggcc
gacaacccggcgagcaccgcggcgcagttggcgaagctggtgggtaacgatttcaaccag
atggacatcggcagttgcgccgacattctcaacggcgtgctcctgccgtccagccgcagc
gacctggcgacgcgcctggtggacctgcgccagggcgcgctcgggcgctgccagtcgttg
caacagcagcaggcggcgcaggcctggaaggacctcgccgactacttcaaccagtacctc
gccggacgcttcccgttcgcctacagcctggaagcggccgatgccgagccggggcgggtg
cggcacctgctgcaactgatggagacgcgcttgccgcaggtgcgcgaagggctggcccag
gttcgctcgccggacctgccggccgccgaggacttcgtccgccgcctggagcaggcgcag
cgctggctcggcccgctgttcgagcgcgacaagtcgggcctgctcggcgtcgccctggac
atcgactggcgcagcgaccgcagcctggaacgcggcgccgaccaggtgatcgcctggagc
ctgtactcgggcgaccaggaaagccgtttccccggcgcgcaggacaagggcctgacctgg
aatgtcggcgatccgctgaaaatcatgctgcgctgggcgaagaacggctcgcagcgtccg
gcagacgacccgcgccaggccagcctggcggtggccgacctcgaggccggctggagctac
cagggctcctgggcgctgttgcgcatgatgcgcgcgcacttctcccggcagcgcccgccg
aacgtcgactacacggagtttccgctggtcctgcaactgccggtgtatgcgccctacagc
ccggaaaacgaggcgcggatgttcctccgcctgtcgttgatgagcctgggcggcaagacc
ccgctgtccatccagccgctgccggtgcgcgcgccgcaatcgccgttcgcgacgctgttg
ccggccaccgtcgccagcaccggaggtaccccatga

DBGET integrated database retrieval system