KEGG   Pseudomonas aeruginosa PAO1: PA2374
Entry
PA2374            CDS       T00035                                 

Definition
(RefSeq) hypothetical protein
Organism
pae  Pseudomonas aeruginosa PAO1
SSDB
Motif
Pfam: MORN_2
Other DBs
NCBI-GeneID: 877895
NCBI-ProteinID: NP_251064
UniProt: Q9I1A5
Position
2626221..2626757
AA seq 178 aa
MAASGKLDLVRGDSHLAGNLLDGSLEGPLRIDEHDRPQASLGYRQGQLHGASTLFHPNGK
VSAQLAFVDGKLHGPASFHAAEGWLQRKAHYRNGLLHGEAFNYFANGQVAEREHYRDGVR
DGVYQRFHGNGQLAFDGRYLNGQLLDGAQPFADDGRPLDSEGKPMARWRWWWTRLAEP
NT seq 537 nt   +upstreamnt  +downstreamnt
atggcggcatccggcaagctcgacctggttcgtggcgacagccatctcgccggcaacctg
ctcgacggcagcctggaaggcccgttgcgcatcgacgagcacgacaggccgcaggccagc
ctcggctaccggcagggccagttgcacggcgccagcaccctgttccatcccaacggcaag
gtctccgcgcaactcgccttcgtcgacggcaagctgcacgggccggcgagtttccatgcc
gcggaaggctggttgcagcgcaaggcgcactaccgcaacgggctgctccacggcgaagcg
ttcaactatttcgccaacggccaggtggccgagcgcgagcattaccgcgacggcgtgcgc
gacggggtctaccagcgcttccatggcaatggccaactggccttcgacggacgctacctg
aacggccagctactggacggcgcccagccgttcgccgacgacggccggccgctggacagc
gagggcaagcccatggcgcgctggcgctggtggtggaccaggctggcggagccctag

DBGET integrated database retrieval system