KEGG   Pseudomonas aeruginosa PAO1: PA2387Help
Entry
PA2387            CDS       T00035                                 

Gene name
fpvI
Definition
(RefSeq) RNA polymerase sigma factor
  KO
K03088  RNA polymerase sigma-70 factor, ECF subfamily
Organism
pae  Pseudomonas aeruginosa PAO1
Brite
KEGG Orthology (KO) [BR:pae00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:pae03021]
    PA2387 (fpvI)
Transcription machinery [BR:pae03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Sigma factors
     PA2387 (fpvI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sigma70_r4_2 Sigma70_r2 Sigma70_r4 Sigma70_ECF HTH_23 GerE HTH_24 HTH_11 PCI Erythro-docking HTH_40 HTH_5 HTH_38 HTH_10
Motif
Other DBs
NCBI-GeneID: 882249
NCBI-ProteinID: NP_251077
UniProt: Q9I193
Position
complement(2640392..2640871)
Genome map
AA seq 159 aa AA seqDB search
MENHYRELLRFLSARLGDRHAAADVAHDAYLRVLERSSQAQIEHPKAFLYRTALNLAVDE
HRRSRVRRAEPLEVLDDEEGLASPSPQTVVDQGQRLDNLQRALAELPAICRSSFLLRKLD
GLSHSQIAEHLNISRSLVEKHIVNAMKHCRVRMREWEAD
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
ttggaaaaccattatcgggagctgctgcgattcctcagtgccaggctcggggatcgacac
gcagcggcggatgtcgcccacgacgcgtatttgcgcgttctggagcgctccagtcaagcg
cagatcgagcatccgaaggcttttctgtaccggacggcgctcaacctggcggtggacgag
caccgtcgcagccgggtgcgccgggcggaacccctggaggtcctggacgacgaggagggc
ctggccagtccctcgccgcagacggtggtcgaccaggggcagcgcctggacaacctgcag
cgcgcgctggccgagttgccggccatctgccgcagttccttcctgttgcgcaagctggac
ggcctgtcccattcgcagatcgccgaacatctcaatatttcccgcagcctggtggaaaag
cacatcgtcaacgcgatgaagcactgtcgggtgcgcatgcgcgaatgggaagccgactga

DBGET integrated database retrieval system