KEGG   Pseudomonas aeruginosa PAO1: PA2390Help
Entry
PA2390            CDS       T00035                                 

Gene name
pvdT
Definition
(RefSeq) pyoverdine biosynthesis protein PvdT
  KO
K05685  macrolide transport system ATP-binding/permease protein [EC:3.6.3.-]
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
pae02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:pae00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    PA2390 (pvdT)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pae02000]
    PA2390 (pvdT)
Enzymes [BR:pae01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.-  
     PA2390 (pvdT)
Transporters [BR:pae02000]
 ABC Transporters, Eukaryotic Type
  Other subfamilies
   Macrolide exporter
    PA2390 (pvdT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MacB_PCD ABC_tran FtsX SMC_N AAA_29 ABC2_membrane_3 AAA_21 AAA_16 MMR_HSR1 RsgA_GTPase AAA_33 AAA_22 AAA_28 HRG AAA_23 DUF87
Motif
Other DBs
NCBI-GeneID: 882237
NCBI-ProteinID: NP_251080
UniProt: Q9I190
Position
2643306..2645297
Genome map
AA seq 663 aa AA seqDB search
MENATQPVPLIELRDIRKRYGGNGTPEVEVLKGVSLSIHAGEFVAIVGASGSGKSTLMNI
LGCLDRPSSGSYHFAGHDVAELDSDEQAWLRREAFGFVFQGYHLIPSASAQENVEMPAIY
AGIPASERHTRARALLERLGLAERTANRPHQLSGGQQQRVSIARALMNGGHIILADEPTG
ALDSHSGAEVMALLDELASQGHVVILITHDRDVAARAKRIIEVRDGEIVSDSANDERPAH
PSAGVERHLQADDLSQRLAEGSSEPSGAWRAELLEAVRAAWRVMWINRFRTALTLLGIII
GVASVVVMLAVGEGSKRQVMAQMGAFGSNIIYLSGYSPNPRAPMGIVSSDDVAAIATLPQ
VKKVMPVNGGELVVRYGNIDYHAYVGGNNTDFPEILNWPVAEGSYFTERDEDAATTVAVI
GYKVRKKLFGSANPIGRYILIENVPFQVIGVLAEKGSSSGDKDADNRIAIPYSAASIRLF
GTRNPEYVIIAAADAQRVHQAERAIDQLMLRLHRGQRDYELTNNAAMIQAEAKTQNTLSL
MLGSIAAISLLVGGIGVMNIMLMTVRERTREIGIRMATGARQGDILRQFLTEAAMLSVVG
GLAGIALALCIGGVLLLGQVAVAFSLSAIVGAFSCALVTGLVFGFMPARKAAQLDPVAAL
ASQ
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacgccacgcaacccgtccccctgatcgaactgcgcgacatccgcaagcgctac
ggcggcaatggcaccccggaagtcgaggtactcaagggcgtatcgctgtcgatccacgcc
ggcgagttcgtcgccatcgtcggcgcctccggctccggcaagtcgaccctgatgaacatc
ctcggctgcctcgaccggcccagctccggcagctaccacttcgccggccacgacgtcgcc
gaactggacagcgacgagcaggcctggctgcgccgcgaggcattcggcttcgtgttccag
ggctatcacctgatcccctccgcctcggcccaggaaaacgtcgagatgccggcgatctac
gccggcatcccggcgagcgagcggcacacccgcgcgcgggccctgctcgaacgcctgggc
ctggccgagcgcaccgccaaccgtccgcaccagttgtccggcggccagcagcagcgggtg
tcgatcgcccgcgcgctgatgaacggcggccatatcatcctcgccgacgaacccaccggc
gccctcgacagccacagcggcgcggaagtcatggcgctgctcgacgagctggccagccag
ggccacgtggtgatcctgatcacccacgaccgcgacgtcgccgcccgcgccaagcgcatc
atcgaggtgcgcgacggcgagatcgtcagcgacagcgccaacgacgagcgcccggcgcac
ccgagcgccggcgtcgagcgccacctgcaggccgacgatctcagccagcgcctcgccgag
ggcagcagcgaaccctcgggggcctggcgcgccgaactgctggaggcggtgcgcgccgcc
tggcgggtgatgtggatcaatcggttccgcaccgcgctgaccctgctcgggatcatcatc
ggcgtcgcctcggtggtggtcatgctcgccgtcggcgagggcagcaagcgccaggtgatg
gcgcagatgggcgcgttcggctcgaacatcatctatctcagcggctactcgccgaacccg
cgcgcgccgatgggcatcgtcagcagcgacgacgtcgccgccatcgccaccctgccccag
gtgaagaaggtcatgccggtgaacggcggcgagctggtggtgcgctacgggaacatcgac
taccacgcctacgtcggcggcaacaacaccgacttcccggaaatcctcaactggccggtg
gccgagggcagctacttcaccgagcgcgacgaagacgccgccaccacggtcgcggtgatc
ggctacaaggtgcgcaagaagctgttcggcagcgccaacccgatcggccgctacatcctc
atcgagaacgtgccgttccaggtcatcggcgtgctcgccgagaaaggctccagctccggc
gacaaggatgccgacaaccgcatcgccatcccctactccgctgccagcatccgcctgttc
ggcacgcgcaaccccgagtacgtgatcatcgccgccgccgacgcccagcgcgtgcaccag
gccgaacgcgccatcgaccagttgatgctgcgcctgcaccgcggccagcgcgactacgag
ctgaccaacaacgcggcgatgatccaggccgaggcgaagacccagaacaccctgtcgctg
atgctcggctcgatcgccgcgatctccctgctggtaggcgggatcggcgtgatgaacatc
atgctcatgaccgtgcgcgaacgcacccgcgagatcggcatccgcatggccactggcgcc
cgccagggcgatatcctccgccagttcctcaccgaggcggcgatgctctcggtggtcggc
ggcctggccgggatcgccctggccctgtgcatcggcggcgtgctgctgctcggccaggtc
gcggtggccttttccctgtcggccatcgtcggcgccttcagttgcgcgctggtcaccggc
ctggtgttcggcttcatgccggcgcgcaaggccgcccagctggacccggtggccgccctg
gccagccaatga

DBGET integrated database retrieval system