KEGG   Pseudomonas aeruginosa PAO1: PA2392Help
Entry
PA2392            CDS       T00035                                 

Gene name
pvdP
Definition
(RefSeq) pyoverdine biosynthesis protein PvdP
Organism
pae  Pseudomonas aeruginosa PAO1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TAT_signal
Motif
Other DBs
NCBI-GeneID: 882224
NCBI-ProteinID: NP_251082
UniProt: Q9I188
Structure
PDB: 

Position
complement(2646776..2648410)
Genome map
AA seq 544 aa AA seqDB search
MTVSRRGFMAGLALTGAAALPVAYYTHRHLTREEEPQTPDEASLDLAATDGIRLGDRLRG
LWDLRLVGGDAELPGLPREGLQLVLDVAPKGRGLIGYLDTPERLLAAEPPRFRVLGDLLG
ASSASIRWRLVDQASGSVAPTHDCSAVFDEVWADYANAGDGTLSGRIQRLERSPLSPNED
FRFVAVKRHFPLAHERIVLNEKLLGWLVSPQHRLFHQLWHASRDKWHRLSEKQRNALRGV
GWQPGPLDRERDARGPRKDRNASGIDFFFMHRHMLHTARSMQDLPSWERLPRPVVPLEYD
RPGFIRYFDNPDGFSVPPAWVAVDDDEYSEWLHGLKSAEAYHANFLVWESQYQDPAYLAK
LTLGQFGSELELGMHDWLHMRWASVTRDPSNGAPVMTDRFPADFAPRWFRPENDFLGDPF
SSHVNPVFWSFHGWIDDRIEDWYRAHERFHPGEVQRREVEGIQWFAPGRWVEVGDPWLGP
ATHGCGLSDVQASSNSVELDVETMKLALRIIFSEEDQLSGWLKRAPRRPWYARNLKLARD
QLRR
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgacggtttctcgacgcggattcatggcgggcctggcccttaccggggcggcggcgctg
ccggtggcttactacacacatcgtcatctgacccgcgaagaggagccgcagacgcctgac
gaggcttcgctcgacctggcggctaccgatggcatacgactgggcgaccgcctgcgcggt
ctatgggacctgcgcctggtaggcggtgatgccgaactgcccgggctgcctcgggagggc
ttgcaactggtgctggacgtggcacccaaggggcgcggcctgattggctacctggatact
cctgaacgtctcctcgcggcggagccgccgcgcttccgtgtgcttggcgacttgctcgga
gccagttctgcaagcatccgctggcgtttggtggaccaggcgagcggttccgtggcgccg
actcacgattgctcggcggtgttcgacgaggtctgggcagactatgcgaacgcgggcgac
ggaaccctgagcggacgcatacagcgcctggagcgttcgccgctgtcgccgaacgaggat
tttcgcttcgttgcggtaaagcgtcacttccccctggcccatgagcgcatcgtgctcaac
gagaaacttctcggttggctggtgtcgccgcagcaccgactgttccaccagctatggcac
gcttcgcgggacaaatggcatcggctttcggaaaaacaacgcaatgcgttgcgcggagtc
ggttggcagcccggcccgctggaccgcgaacgcgatgcgcgagggccgcgcaaggatcgc
aatgcctcgggtatcgacttctttttcatgcaccggcacatgctgcacaccgcgcgttcc
atgcaggacctgccgtcctgggagcgtctgccgcgacctgtggtgccgctggagtacgat
cgtcccggcttcatccgttacttcgacaatccggacgggttttccgtgcctccggcctgg
gtggcagtggatgacgacgagtacagcgagtggctgcatggcctgaaaagcgccgaggcc
taccatgccaatttcctggtctgggaatcgcagtaccaggacccggcgtacctggcgaag
ctgaccctcggccagttcggttcggagctggaactgggcatgcatgactggctgcacatg
cgctgggcctcggtgacgagggacccctccaacggcgccccggtcatgaccgaccgtttt
ccggccgatttcgccccgcgctggttccgcccggagaacgacttcctcggcgacccgttt
tcctcccatgtgaatccggtgttctggtcgttccacggctggatcgacgaccgcatcgag
gactggtatcgcgcccacgagcgtttccatcctggcgaagtgcagcgccgcgaagtggag
ggcatccaatggttcgcgcccggtcgatgggtcgaggtcggcgatccctggctgggcccg
gcgacccatggatgcgggctctcggatgtccaggcgagcagcaactcggtggagctggac
gtggaaaccatgaagctggctttgcgcatcatcttcagcgaagaagatcaactgagcggc
tggctcaagcgtgcgccgcggcggccctggtacgcgcgcaacctgaagctggcgcgcgac
cagctcaggcgctga

DBGET integrated database retrieval system