KEGG   Pseudomonas aeruginosa PAO1: PA2570
Entry
PA2570            CDS       T00035                                 

Gene name
lecA
Definition
(RefSeq) PA-I galactophilic lectin
  KO
K20258  PA-I galactophilic lectin
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
pae02024  Quorum sensing
pae02025  Biofilm formation - Pseudomonas aeruginosa
Brite
KEGG Orthology (KO) [BR:pae00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    PA2570 (lecA)
   02025 Biofilm formation - Pseudomonas aeruginosa
    PA2570 (lecA)
SSDB
Motif
Pfam: PA-IL
Other DBs
NCBI-GeneID: 882335
NCBI-ProteinID: NP_251260
UniProt: Q05097
Structure
PDB: 

Position
complement(2905182..2905550)
AA seq 122 aa
MAWKGEVLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDREHPDQGLICHD
AFCGALVMKIGNSGTIPVNTGLFRWVAPNNVQGAITLIYNDVPGTYGNNSGSFSVNIGKD
QS
NT seq 369 nt   +upstreamnt  +downstreamnt
atggcttggaaaggtgaggttctggctaataacgaagcagggcaggtaacgtcgattatc
tacaatccgggcgatgtcattaccatcgtcgccgccggttgggccagttacggacctacc
cagaaatgggggccgcagggcgatcgggagcatccggaccaagggctgatctgccacgat
gcgttttgtggtgcgctggtcatgaagattggcaacagcggaaccattccggtcaatacc
gggttgttccgttgggttgcacccaataatgtccagggtgcaatcactcttatctacaac
gacgtgcccggaacctatggcaataactccggctcgttcagtgtcaatattggaaaggat
cagtcctga

DBGET integrated database retrieval system