KEGG   Pseudomonas aeruginosa PAO1: PA2688
Entry
PA2688            CDS       T00035                                 
Symbol
pfeA
Name
(RefSeq) ferric enterobactin receptor
  KO
K19611  ferric enterobactin receptor
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
pae02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pae00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PA2688 (pfeA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pae02000]
    PA2688 (pfeA)
Transporters [BR:pae02000]
 Other transporters
  Pores ion channels [TC:1]
   PA2688 (pfeA)
SSDB
Motif
Pfam: TonB_dep_Rec Plug
Other DBs
NCBI-GeneID: 882784
NCBI-ProteinID: NP_251378
UniProt: Q05098
Structure
Position
3040242..3042482
AA seq 746 aa
MSSRALPAVPFLLLSSCLLANAVHAAGQGDGSVIELGEQTVVATAQEETKQAPGVSIITA
EDIAKRPPSNDLSQIIRTMPGVNLTGNSSSGQRGNNRQIDIRGMGPENTLILVDGKPVSS
RNSVRYGWRGERDSRGDTNWVPADQVERIEVIRGPAAARYGNGAAGGVVNIITKQAGAET
HGNLSVYSNFPQHKAEGASERMSFGLNGPLTENLSYRVYGNIAKTDSDDWDINAGHESNR
TGKQAGTLPAGREGVRNKDIDGLLSWRLTPEQTLEFEAGFSRQGNIYTGDTQNTNSNNYV
KQMLGHETNRMYRETYSVTHRGEWDFGSSLAYLQYEKTRNSRINEGLAGGTEGIFDPNNA
GFYTATLRDLTAHGEVNLPLHLGYEQTLTLGSEWTEQKLDDPSSNTQNTEEGGSIPGLAG
KNRSSSSSARIFSLFAEDNIELMPGTMLTPGLRWDHHDIVGDNWSPSLNLSHALTERVTL
KAGIARAYKAPNLYQLNPDYLLYSRGQGCYGQSTSCYLRGNDGLKAETSVNKELGIEYSH
DGLVAGLTYFRNDYKNKIESGLSPVDHASGGKGDYANAAIYQWENVPKAVVEGLEGTLTL
PLADGLKWSNNLTYMLQSKNKETGDVLSVTPRYTLNSMLDWQATDDLSLQATVTWYGKQK
PKKYDYHGDRVTGSANDQLSPYAIAGLGGTYRLSKNLSLGAGVDNLFDKRLFRAGNAQGV
VGIDGAGAATYNEPGRTFYTSLTASF
NT seq 2241 nt   +upstreamnt  +downstreamnt
atgtcctcacgcgcccttcccgccgttcccttcctgctgctgtccagttgcctgctcgcc
aacgccgtacacgccgccggccagggcgacggctccgtcatcgagctgggcgagcagacc
gtggtcgccaccgcccaggaggaaaccaagcaggcgccgggggtttccatcatcaccgcc
gaggacatcgccaagcgaccgccgagcaacgacctgtcgcagatcatccggaccatgccg
ggggtcaacctgaccggcaacagctccagcggccagcgtggaaacaaccggcagatcgac
atccgcggcatgggcccggagaacaccctgatcctggtcgacggcaagccggtcagctcg
cgcaactcggtgcgctacggctggcgcggcgagcgcgacagccgcggcgacaccaactgg
gtgccggccgaccaggtcgagcgcatcgaagtgatccgcggcccggcggcggcgcgctac
ggcaacggcgcggcgggcggcgtggtgaacatcatcaccaagcaggccggcgcggaaacc
cacggtaatctcagcgtctacagcaatttcccgcaacacaaggccgaaggcgccagcgaa
cggatgagcttcggtctcaacgggccgctcacggaaaacctcagctaccgcgtctacggc
aacatcgccaagaccgactcggacgactgggacatcaacgccggccacgaatccaaccgt
accggcaagcaggccggcaccctccccgccggtcgcgaaggcgtgcgcaacaaggacatc
gacgggctgctcagctggcgcctgacgcccgagcagaccctcgagttcgaggccggcttc
agccgccagggcaacatctacaccggcgacacgcagaacaccaacagcaacaactacgtg
aagcagatgctcggccacgagaccaaccgcatgtaccgcgagacctactcggtcacccat
cgcggcgaatgggacttcggcagctcgctggcctacctgcagtacgagaagacccgcaac
agccggatcaacgaaggcctggccggcggcaccgaaggtatcttcgaccccaacaacgcc
ggcttctacaccgccaccctgcgcgacctgaccgcccacggcgaggtcaacctgccgctg
cacctgggctacgagcagaccctgaccctcggcagcgagtggaccgagcagaagctcgac
gaccccagctccaacacccagaacaccgaggaaggcggctcgatccccggtctcgccgga
aagaaccgcagcagcagttcctcggcgcggatcttctcgctgttcgccgaggacaacatc
gagctgatgcccggcaccatgctcaccccaggcctgcgctgggaccaccacgacatcgtc
ggcgacaactggagcccatcgctgaacctgtcccacgcgctcaccgagcgggtcaccctg
aaggccggtatcgcccgcgcctacaaggcccccaacctgtaccagctgaaccccgactac
ctgctctacagccgtggccagggttgctacgggcaaagcaccagttgctacctgcgcggc
aacgacggcctcaaggccgagaccagcgtgaacaaggaactgggcatcgagtacagccac
gacggcctggtagcggggctgacctacttccgcaacgactacaagaacaagatcgaatcc
ggcctgtcaccggtcgaccacgccagcggcggcaagggcgactacgccaacgcggcgatc
taccagtgggagaacgtgcccaaggcggtggtcgagggcctcgaaggcaccctgaccctg
cccctggccgacggcctgaagtggagcaacaacctcacctacatgctgcaatcgaagaac
aaggaaaccggcgacgtgctctcggtgacgccgcgctacaccctcaactcgatgctcgac
tggcaggccaccgacgacctctcgctgcaagccacggtcacctggtacggcaagcagaag
ccgaagaaatacgactatcacggcgaccgtgtcaccggcagcgccaacgaccagctctcg
ccctacgccatcgccggcctcggcggcacctatcggttgagcaagaacctgagcctcggc
gccggcgtcgacaacctgttcgacaagcgcctgttccgcgccggcaatgcccagggcgtg
gtcggcatcgacggggccggcgcggcgacctacaacgagcccggacggaccttctatacc
agcctgaccgcgtcgttctga

DBGET integrated database retrieval system