KEGG   Pseudomonas aeruginosa PAO1: PA2702Help
Entry
PA2702            CDS       T00035                                 

Definition
(RefSeq) hypothetical protein
Organism
pae  Pseudomonas aeruginosa PAO1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADPRTs_Tse2
Motif
Other DBs
NCBI-GeneID: 880323
NCBI-ProteinID: NP_251392
UniProt: Q9I0E0
Structure
PDB: 

Position
3056890..3057366
Genome map
AA seq 158 aa AA seqDB search
MSYDYEKTSLTLYRAVFKANYDGDVGRYLHPDKELAEAAEVAPLLHPTFDSPNTPGVPAR
APDIVAGRDGLYAPDTGGTSVFDRAGVLRRADGDFVIPDGTDIPPDLKVKQDSYNKRLQA
THYTIMPAKPMYREVLMGQLDNFVRNAIRRQWEKARGL
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgtcctacgactacgagaaaaccagcctcaccctctaccgggcggtattcaaggccaac
tacgacggcgacgtcggtcgctacctgcatcccgacaaggaactcgccgaggctgcggaa
gtcgccccgctgctgcatccgaccttcgacagccccaacacccctggcgtccccgcccgc
gcgccggacatcgtcgccggccgcgacggcctctacgccccggacaccggcggcacctcg
gtgttcgaccgcgccggcgtgctgcgccgcgccgacggcgacttcgtgatacccgacggc
accgacatcccgccggaccttaaggtgaagcaggacagctacaacaagcgcctgcaagcc
acccactacaccatcatgccggccaagccgatgtaccgggaggtcctcatgggccaactg
gacaacttcgtgcgcaacgccatccgccgccaatgggaaaaagcccgcgggctctag

DBGET integrated database retrieval system