KEGG   Pseudomonas aeruginosa PAO1: PA2738Help
Entry
PA2738            CDS       T00035                                 

Gene name
himA
Definition
(RefSeq) integration host factor subunit alpha
  KO
K04764  integration host factor subunit alpha
Organism
pae  Pseudomonas aeruginosa PAO1
Brite
KEGG Orthology (KO) [BR:pae00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:pae03032]
    PA2738 (himA)
   03036 Chromosome and associated proteins [BR:pae03036]
    PA2738 (himA)
   03400 DNA repair and recombination proteins [BR:pae03400]
    PA2738 (himA)
DNA replication proteins [BR:pae03032]
 Prokaryotic type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    PA2738 (himA)
Chromosome and associated proteins [BR:pae03036]
 Prokaryotic type
  Nucleoid associated proteins
   IHF (integration host factor)
    PA2738 (himA)
DNA repair and recombination proteins [BR:pae03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     Facilitator
      PA2738 (himA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Bac_DNA_binding HU-CCDC81_bac_2 HU-HIG HU-CCDC81_euk_2 Meth_synt_1 HrcA
Motif
Other DBs
NCBI-GeneID: 882954
NCBI-ProteinID: NP_251428
UniProt: Q51472
Position
complement(3099810..3100112)
Genome map
AA seq 100 aa AA seqDB search
MGALTKAEIAERLYEELGLNKREAKELVELFFEEIRQALEHNEQVKLSGFGNFDLRDKRQ
RPGRNPKTGEEIPITARRVVTFRPGQKLKARVEAYAGTKS
NT seq 303 nt NT seq  +upstreamnt  +downstreamnt
atgggggctctgacgaaagctgaaattgcggaacgtctgtacgaagagctgggcctgaac
aaacgggaagccaaggagttggtggagttgttcttcgaagagatccgccaggcgctggag
cataacgagcaggtcaagttgtccggtttcggcaacttcgacctgcgcgacaagcgccag
cgccccggacgcaacccaaagaccggcgaagaaatcccgatcacggcccgccgcgttgtc
acctttcgtccagggcagaaactgaaggccagggttgaggcatatgctggaaccaagtca
taa

DBGET integrated database retrieval system