KEGG   Pseudomonas aeruginosa PAO1: PA2774
Entry
PA2774            CDS       T00035                                 

Definition
(RefSeq) hypothetical protein
Organism
pae  Pseudomonas aeruginosa PAO1
SSDB
Other DBs
NCBI-GeneID: 882745
NCBI-ProteinID: NP_251464
UniProt: Q9I069
Position
complement(3132229..3132816)
AA seq 195 aa
MSQLPIPLPLNESRWRYVTASGGGMTVAFLAGSGGSITLLSPEGENVSFRYGGVGGGIGL
GMRLPRFGKVNLNVKGKSVGGAGALEALPSTGTVLVADGLVGRDLSRGDFTGPCMYVELG
AGVIAGGSGTAILFGLDPKLLAAVALASASPLTAALGASMSRQLLQSSRGALLMAGVNVG
AQFGGGAAAYLGALF
NT seq 588 nt   +upstreamnt  +downstreamnt
atgtcgcaacttcccattcccttgcccctcaacgagagtcgctggcgctacgtgacggcc
agtggcggaggcatgaccgtggccttcctggcgggtagcggcggctccatcacgttgctc
tcgccggagggtgagaacgtgtccttccgctatggcggggtgggcggcgggatcggactg
ggcatgcgcctgccgcgcttcggcaaggtcaacctcaatgtcaagggcaagagcgttggc
ggggccggtgcgctggaggcgttgccgagcaccggaaccgtcttggtcgcggacggcctg
gtggggcgcgacctgtcccgcggcgacttcaccgggccctgcatgtacgtcgaactcggc
gcgggagtcatcgccggcggttcgggcacggcgatcctcttcggcctcgatcccaagctg
ctggcggcggtggcgctggcgagcgcctcgccattgaccgccgcgctgggcgccagcatg
tcgcggcaattactgcaatcgtcccgtggcgccctgttgatggccggggtcaacgtcggt
gcacagttcggcggcggcgcggcggcttacctgggggcgttgttctga

DBGET integrated database retrieval system