KEGG   Pseudomonas aeruginosa PAO1: PA2775Help
Entry
PA2775            CDS       T00035                                 

Definition
(RefSeq) hypothetical protein
Organism
pae  Pseudomonas aeruginosa PAO1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3592
Motif
Other DBs
NCBI-GeneID: 880541
NCBI-ProteinID: NP_251465
UniProt: Q9I068
Position
complement(3132821..3133258)
Genome map
AA seq 145 aa AA seqDB search
MTTSSGSRIGGLLHASLFSLLGLGLLLAGGFKTVERYHFLRTAQEAQGTVSALNAGGSHP
QIDFTSVSGERISYPQGGFIFGYQVGEPVRVLYEAGRPAASAIVDDAGALWGTGAFLCGF
GALFGIVGFRGLLGLRSSQPTSKGH
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atgacgacctcttccggttcgcgtatcggcggacttcttcacgcttcccttttttccctg
ctcggactcggtctcctgctcgccggcggtttcaagaccgtcgagcggtaccatttcctg
cgtactgcgcaggaagcccaggggacggtcagcgccttgaatgccggcggttcgcatccg
cagatcgatttcaccagcgtttccggcgagcggatttcctatccccagggcggcttcatc
ttcggctaccaggtgggcgagccggttcgcgtcctctacgaggctgggcggccggcggcc
agcgcgatagtcgacgatgccggcgcgctctggggaaccggcgctttcctctgcggcttc
ggcgcactcttcggtattgtcgggttcaggggattgctgggcctgcgttcttcccaaccg
acctcaaaaggacattga

DBGET integrated database retrieval system