KEGG   Pseudomonas aeruginosa PAO1: PA2787Help
Entry
PA2787            CDS       T00035                                 

Gene name
cpg2
Definition
(RefSeq) glutamate carboxypeptidase
  KO
K01295  glutamate carboxypeptidase [EC:3.4.17.11]
Organism
pae  Pseudomonas aeruginosa PAO1
Brite
KEGG Orthology (KO) [BR:pae00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pae01002]
    PA2787 (cpg2)
Enzymes [BR:pae01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.11  glutamate carboxypeptidase
     PA2787 (cpg2)
Peptidases and inhibitors [BR:pae01002]
 Metallo peptidases
  Family M20
   PA2787 (cpg2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28 CHASE3
Motif
Other DBs
NCBI-GeneID: 882782
NCBI-ProteinID: NP_251477
UniProt: Q9I056
Position
3143152..3144390
Genome map
AA seq 412 aa AA seqDB search
MHARRLPRLLPLALAFLLSPAAFAADTPAAELLRQAEAERPAYLDTLRQLVAVDSGTGQA
EGLGQLSALLAERLQALGAQVRSAPATPSAGDNLVATLDGTGSKRFLLMIHYDTVFAAGS
AAKRPFREDAERAYGPGVADAKGGVAMVLHALALLRQQGFRDYGRITVLFNPDEETGSAG
SKQLIAELARQQDYVFSYEPPDRDAVTVATNGIDGLLLEVKGRSSHAGSAPEQGRNAILE
LSHQLLRLKDLGDPAKGTTLNWTLARGGEKRNIIPAEASAEADMRYSDPAESERVLADAR
KLTGERLVADTEVSLRLDKGRPPLVKNPASQRLAETAQTLYGRIGKRIEPIAMRFGTDAG
YAYVPGSDKPAVLETLGVVGAGLHSEAEYLELSSIAPRLYLTVALIRELSAD
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
gtgcacgcccgccgcctgccccgcctcttgccgctcgccctcgccttcctgctttcgccc
gccgccttcgctgccgacacgccagccgccgagctgctgcgccaggccgaagccgaacgc
ccggcctacctcgacacgctccggcaactggtcgcggtggacagcggtaccggccaggcc
gaaggcctcggccagttgtccgcgctgctcgccgaacgcctgcaggcgctcggcgcgcaa
gtccgcagcgcaccggcgacgccctcggccggcgacaacctggtggccaccctcgatggc
accggcagcaagcgcttcctgctgatgattcactacgacaccgtgttcgccgccggcagc
gcggcgaagcgtccgttccgcgaggacgcggagcgcgcctacggacccggcgtggccgac
gccaagggcggcgtggcgatggtgctgcatgccctggcgctgctcaggcagcaaggcttc
agggactacggacggatcaccgtgctgttcaatcccgacgaagagaccggctccgccggc
tcgaagcaactgatcgccgagctggcccggcagcaggactacgtcttctcctacgagccg
ccggaccgggacgcagtgacggtagccaccaatggcatcgacggcctgctgctcgaggtg
aagggtcgctcgtcccatgccggctcggcacccgagcaaggccgcaacgccattctcgaa
ctgtcgcaccagttgctgcgtctcaaggacctcggcgatccggcgaaaggcaccacgctg
aactggaccctcgccaggggcggcgagaagcgcaacatcattcccgccgaggcttcggcg
gaagccgacatgcgctactcggacccggccgagagcgagcgggtactggccgacgcccgg
aagctgaccggcgaacgcctggtcgccgataccgaagtcagtctgcgtctcgacaagggt
cgtccgcctctggtgaagaaccccgcctcgcagcgcctggcggaaaccgcgcagacgctc
tacggccgaatcggcaagcgcatcgagccgatcgccatgcgcttcggcacggacgccggc
tacgcctacgtgcccggcagcgacaaaccggcggtgctggaaaccctcggcgtggtcggc
gccggcctgcacagcgaggcggaatacctcgaactatccagcatcgccccccgcctgtac
ctgacggtggcgctgatccgcgagctgtccgccgactag

DBGET integrated database retrieval system