KEGG   Pseudomonas aeruginosa PAO1: PA3005Help
Entry
PA3005            CDS       T00035                                 

Gene name
nagZ
Definition
(RefSeq) beta-hexosaminidase
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
pae00520  Amino sugar and nucleotide sugar metabolism
pae01100  Metabolic pathways
pae01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:pae00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    PA3005 (nagZ)
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    PA3005 (nagZ)
Enzymes [BR:pae01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     PA3005 (nagZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3
Motif
Other DBs
NCBI-GeneID: 880216
NCBI-ProteinID: NP_251695
PathoGenesis: PA3005
UniProt: Q9HZK0
Structure
PDB: 

Position
complement(3365756..3366754)
Genome map
AA seq 332 aa AA seqDB search
MQGSLMLDIGGTWLTAEDRQILRHPEVGGLIIFARNIEHPAQVRELCAAIRAIRPDLLLA
VDQEGGRVQRLRQGFVRLPAMRAIADNPNAEELAEHCGWLMATEVQAVGLDLSFAPVLDL
DHQRSAVVGSRAFEGDPERAALLAGAFIRGMHAAGMAATGKHFPGHGWAEADSHVAIPED
ARSLEEIRRSDLVPFARLAGQLDALMPAHVIYPQVDPQPAGFSRRWLQEILRGELKFDGV
IFSDDLSMAGAHVVGDAASRIEAALAAGCDMGLVCNDRASAELALAALQRLKVTPPSRLQ
RMRGKGYANTDYRQQPRWLEALSALRAAQLID
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgcaaggctctctgatgctcgacatcggcggcacctggctgaccgccgaggaccgccaa
atcctgcgccaccccgaggtgggcgggctgatcatcttcgctcgcaacatcgagcatcct
gcccaggttcgcgaactgtgtgcggccattcgcgccatccgtcccgacctgttgctggcc
gtcgaccaggaaggagggcgcgtgcagcgcctgcgccagggcttcgtgcgcctgccggcg
atgcgcgcgatcgccgacaaccccaatgccgaagagctggccgagcattgtggctggctg
atggcgaccgaggtgcaggcggtcggcctcgacctgagtttcgcgccggtgctggatctc
gatcaccagcgcagcgccgtggtcggtagccgcgccttcgagggcgacccggagcgtgcc
gcgctgcttgccggtgctttcattcgcggcatgcatgccgccgggatggccgccaccggc
aagcattttcccggtcacggctgggccgaggccgattcccatgtggcgattcccgaagac
gcgcgcagtctcgaggaaatccggcgcagcgacctggttccgttcgcccgcctggccgga
cagctcgacgcgctgatgccggcccatgtcatctatccgcaggtcgacccgcagcccgcc
ggcttttcccggcgctggttgcaggagatcctgcgcggcgagctgaagttcgacggggtg
atattcagcgacgacctgtcgatggccggcgcccatgtggtcggcgacgccgccagccgc
atcgaggccgccctggccgcgggctgcgacatgggcctggtgtgcaacgaccgggcttcc
gccgagctggccctggctgccctgcaacgcctgaaggtgaccccgccgtcgcgtctgcaa
cgcatgcgtggcaagggctacgcgaataccgactatcgccagcagccgcgctggctggaa
gcactgtccgcgttgcgcgctgcgcaactgattgattga

DBGET integrated database retrieval system