KEGG   Pseudomonas aeruginosa PAO1: PA3007Help
Entry
PA3007            CDS       T00035                                 

Gene name
lexA
Definition
(RefSeq) LexA repressor
  KO
K01356  repressor LexA [EC:3.4.21.88]
Organism
pae  Pseudomonas aeruginosa PAO1
Brite
KEGG Orthology (KO) [BR:pae00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pae01002]
    PA3007 (lexA)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pae03400]
    PA3007 (lexA)
Enzymes [BR:pae01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.88  repressor LexA
     PA3007 (lexA)
Peptidases and inhibitors [BR:pae01002]
 Serine peptidases
  Family S24: LexA family
   PA3007 (lexA)
DNA repair and recombination proteins [BR:pae03400]
 Prokaryotic type
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    PA3007 (lexA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LexA_DNA_bind Peptidase_S24 HTH_20 MarR_2 Sigma70_r4 HTH_Crp_2 Rrf2
Motif
Other DBs
NCBI-GeneID: 879875
NCBI-ProteinID: NP_251697
UniProt: P37452
Position
3367903..3368517
Genome map
AA seq 204 aa AA seqDB search
MQKLTPRQAEILSFIKRCLEDHGFPPTRAEIAQELGFKSPNAAEEHLKALARKGAIEMTP
GASRGIRIPGFEPHAANDDEGLPVIGRVAAGAPILAEQNIEESCRINPAFFNPRADYLLR
VRGMSMKDIGILDGDLLAVHVTREARNGQVVVARIGEEVTVKRFKREGSKVWLLAENPEF
APIEVDLKEQELIIEGLSVGVIRR
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgcagaagctgacgccccgccaagccgagatcctctccttcatcaagcgctgcctggaa
gaccacggctttccgccgacccgggcggaaatcgcccaggaactcggcttcaagtcgccg
aacgccgccgaggagcacctcaaggcgctggcacgcaagggcgccatcgaaatgactccg
ggcgcctctcgcggcatccgcattcccggcttcgaaccgcatgccgccaacgacgatgag
ggcctgccggtgatcggacgggtcgccgccggcgcaccgatcctcgccgaacagaacatc
gaggaatcctgccgtatcaatcccgccttcttcaatcctcgcgccgactacctgttgcgc
gtgcgcggcatgagcatgaaggacatcggcatcctcgacggcgacctgctggccgtccac
gtcacccgcgaagcgcgcaacggccaggtggtggtcgcgcggatcggcgaggaggtcacg
gtgaaacgcttcaagcgcgaaggcagcaaggtctggctgctggcggaaaaccctgagttc
gctccgatcgaagtcgatctgaaggagcaggaactgatcatcgaaggcttgagcgtcggc
gtgatccggcgctga

DBGET integrated database retrieval system