KEGG   Pseudomonas aeruginosa PAO1: PA3183
Entry
PA3183            CDS       T00035                                 

Gene name
zwf
Definition
(RefSeq) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
pae00030  Pentose phosphate pathway
pae00480  Glutathione metabolism
pae01100  Metabolic pathways
pae01110  Biosynthesis of secondary metabolites
pae01120  Microbial metabolism in diverse environments
pae01200  Carbon metabolism
Module
pae_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:pae00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PA3183 (zwf)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    PA3183 (zwf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pae04147]
    PA3183 (zwf)
Enzymes [BR:pae01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     PA3183 (zwf)
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     PA3183 (zwf)
Exosome [BR:pae04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   PA3183 (zwf)
  Exosomal proteins of colorectal cancer cells
   PA3183 (zwf)
  Exosomal proteins of bladder cancer cells
   PA3183 (zwf)
SSDB
Motif
Pfam: G6PD_C G6PD_N GFO_IDH_MocA
Other DBs
NCBI-GeneID: 882681
NCBI-ProteinID: NP_251873
UniProt: O68282
Position
complement(3572324..3573793)
AA seq 489 aa
MPDVRVLPCTLALFGALGDLALRKLFPALYQLDRENLLHRDTRVLALARDEGAPAEHLAT
LEQRLRLAVPAKEWDDVVWQRFRERLDYLSMDFLDPQAYVGLREAVDDELPLVAYFATPA
SVFGGICENLAAAGLAERTRVVLEKPIGHDLESSREVNEAVARFFPESRIYRIDHYLGKE
TVQNLIALRFANSLFETQWNQNHISHVEITVAEKVGIEGRWGYFDQAGQLRDMVQNHLLQ
LLCLIAMDPPSDLSADSIRDEKVKVLRALEPIPAEQLASRVVRGQYTAGFSDGKAVPGYL
EEEHANRDSDAETFVALRVDIRNWRWSGVPFYLRTGKRMPQKLSQIVIHFKEPPHYIFAP
EQRSLISNRLIIRLQPDEGISLQVMTKDQGLGKGMQLRTGPLQLSFSETYHAARIPDAYE
RLLLEVTQGNQYLFVRKDEVEFAWKWCDQLIAGWERLSEAPKPYPAGSWGPVASVALVAR
DGRSWYGDF
NT seq 1470 nt   +upstreamnt  +downstreamnt
atgcctgatgtccgcgttctgccttgcacgttagcgctgttcggtgcgctgggcgatctc
gccttgcgcaagctgttcccggcgctctaccaactcgatcgtgagaacctgctgcaccgc
gatacccgcgtcctggccctggcccgtgacgaaggcgctcccgccgaacacctggcgacg
ctggagcagcgcctgcgcctggcagtgccggcgaaggagtgggacgacgtggtctggcag
cgtttccgcgaacgcctcgactacctgagcatggacttcctcgacccgcaggcctatgtc
ggcttgcgcgaggcggtggatgacgaactgccgctggtcgcctacttcgccacgccggcc
tcggtgttcggcggcatctgcgagaacctcgccgccgccggtctcgccgagcgcacccgg
gtggtgctggagaagcccatcggtcatgacctggagtcgtcccgcgaggtcaacgaggca
gtcgcccggttcttcccggaaagccgcatctaccggatcgaccattacctgggcaaggag
acggtgcagaacctgatcgccctgcgcttcgccaacagcctcttcgagacccagtggaac
cagaaccacatctcccacgtggagatcaccgtggccgagaaggtcggcatcgaaggccgc
tggggctacttcgaccaggccgggcaactgcgcgacatggtgcagaaccacctgctgcaa
ctgctctgcctgatcgccatggatccgcccagcgacctttcggcggacagcattcgcgac
gagaaggtcaaggtcctccgcgccctcgagccgattcccgcagaacaactggcttcgcgc
gtggtgcgtgggcagtacaccgccggtttcagcgacggcaaggcagtgccgggctacctg
gaggaggaacatgcgaatcgcgacagcgacgcggaaaccttcgtcgccctgcgcgtggac
atccgcaactggcgctggtcgggcgtgccgttctacctgcgcaccggcaagcgcatgccg
cagaagctgtcgcagatcgtcatccacttcaaggagccgccgcactacatcttcgctccc
gagcagcgttcgctgatcagcaaccggctgatcatccgcctgcagccggacgaaggtatc
tccctgcaagtgatgaccaaggaccagggcctgggcaagggcatgcaattgcgtaccggc
ccgctgcaactgagtttttccgagacctaccacgcggcgcggattcccgatgcctacgag
cgtctgctgctggaggtcacccagggcaaccagtacctgttcgtgcgcaaggacgaggtg
gagttcgcctggaagtggtgcgaccagctgatcgctggctgggaacgcctgagcgaagcg
cccaagccgtatccggcggggagttgggggccggtggcctcggtggccctggtggcccgc
gatgggaggagttggtatggcgatttctga

DBGET integrated database retrieval system