KEGG   Pseudomonas aeruginosa PAO1: PA3361
Entry
PA3361            CDS       T00035                                 

Gene name
lecB
Definition
(RefSeq) fucose-binding lectin PA-IIL
  KO
K20277  mannose-binding lectin
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
pae02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:pae00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    PA3361 (lecB)
SSDB
Motif
Pfam: PA-IIL DUF4114 Triabin
Other DBs
NCBI-GeneID: 882528
NCBI-ProteinID: NP_252051
UniProt: Q9HYN5
Structure
PDB: 

Position
3773029..3773376
AA seq 115 aa
MATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNETAATFSGQSTNNAVIGTQVLNSGS
SGKVQVQVSVNGRPSDLVSAQVILTNELNFALVGSEDGTDNDYNDAVVVINWPLG
NT seq 348 nt   +upstreamnt  +downstreamnt
atggcaacacaaggagtgttcacccttcccgccaacacccggttcggcgtcaccgccttc
gccaactcgtccggaacccagacggtgaacgtgctggtcaacaacgagacggccgcgacc
ttcagcgggcaaagcaccaataacgccgtcatcggcacccaggtgctcaactccggcagc
agtggcaaggtacaggtccaggtcagcgtcaacggccgcccctcggatctggtctcggca
caggtaatcctgaccaacgagctgaacttcgccctggtcggctctgaagacggcaccgac
aacgactacaacgacgccgtcgtggtgatcaactggccgctcggctag

DBGET integrated database retrieval system