KEGG   Pseudomonas aeruginosa PAO1: PA3362
Entry
PA3362            CDS       T00035                                 

Name
(RefSeq) transporter protein AmiS
  KO
K22112  putative amide transporter protein
Organism
pae  Pseudomonas aeruginosa PAO1
Brite
KEGG Orthology (KO) [BR:pae00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pae02000]
    PA3362
Transporters [BR:pae02000]
 Other transporters
  Pores ion channels [TC:1]
   PA3362
SSDB
Motif
Pfam: AmiS_UreI
Other DBs
NCBI-GeneID: 880572
NCBI-ProteinID: NP_252052
UniProt: Q51417
Position
complement(3773430..3773948)
AA seq 172 aa
MMLGLVLLYVGAVLFLNAVWLLGKISGREVAVINFLVGVLSACVAFYLIFSAAAGQGSLK
AGALTLLFAFTYLWVAANQFLEVDGKGLGWFCLFVSLTACTVAIESFAGASGPFGLWNAV
NWTVWALLWFCFFLLLGLSRSIQKPVAYLTLASAIFTAWLPGLLLLGQVLKA
NT seq 519 nt   +upstreamnt  +downstreamnt
atgatgctgggactggttctgctgtacgttggcgcggtgctgtttctcaatgccgtctgg
ttgctgggcaagatcagcggtcgggaggtggcggtgatcaacttcctggtcggcgtgctg
agcgcctgcgtcgcgttctacctgatcttttccgcagcagccgggcagggctcgctgaag
gccggagcgctaaccctgctattcgcttttacctatctgtgggtggccgccaaccagttc
ctcgaggtggacggcaagggcctcggctggttctgcctgttcgtcagcctcaccgcctgc
accgtggcgatcgagtcgttcgccggcgccagtggtccgttcggcctgtggaacgcggtc
aactggacagtctgggcgttgctctggttctgtttcttcctgctgctggggctgtcccgc
agcatccagaagccggtggcctacctgaccctggccagcgccatattcaccgcctggttg
cccggcctgctgctgctcgggcaggtgctcaaggcatag

DBGET integrated database retrieval system